Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g882.t1
Gene name
Locationscaffold_01:2354718..2355914
Strand+
Gene length (bp)1196
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03820 SFXNs Sideroflexins 1.1E-128 10 339

GO

GO Term Description Terminal node
GO:0015075 ion transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 148 167 19
2 179 201 22
3 250 272 22
4 285 307 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g882.t1
MSASLPGSRDLPASPYDLKTYWGRVRHAADLSDPRTMFVSSAGLENAKNLIASYKQNRIPAMTPELWSAKKIVDA
TLHPDTGMPVFLPFRMSCYVLSNLVVTAGMLTPGLKTTGTVLWQIGNQSLNVAVNNANANKSTPLSMSQIGKSYL
LAVSASCSVAVGLNALVPRLKSISPNTRLILSRLVPFAAVASASALNVFLMRGNEIRHGIDIYPVLSEAERAKRE
LGEHAEPVQSIGKSKKAATLAVGETAISRVLNATPIMVLPPLILVRLEKTDWLRARPRMVLPINLALILGTSLFA
LPLALAAFPARQAINVKSLEEEFHGRGGDLGMVEFNRGM*
Coding >Pro_DTO377G3_2|g882.t1
ATGTCTGCCTCTCTCCCTGGCAGTCGGGACCTGCCTGCGTCGCCATATGACCTGAAGACCTATTGGGGTCGCGTG
CGCCATGCCGCCGACCTTTCTGATCCTCGGACTATGTTTGTTTCGTCCGCCGGGCTTGAAAACGCCAAGAACCTG
ATTGCTTCTTACAAGCAGAACCGCATCCCGGCCATGACACCGGAGTTGTGGTCGGCGAAGAAGATCGTTGATGCG
ACATTGCACCCTGATACTGGAATGCCCGTCTTCTTGCCTTTCCGCATGTCGTGCTACGTGCTCTCGAACTTGGTC
GTCACTGCAGGCATGCTGACTCCAGGATTGAAGACAACCGGAACCGTCCTCTGGCAAATCGGTAACCAATCCCTC
AATGTCGCCGTCAACAACGCAAACGCCAACAAATCTACCCCCCTCTCCATGTCGCAAATTGGCAAGTCATACCTC
CTGGCCGTCTCGGCCTCTTGCTCCGTCGCAGTCGGTCTGAACGCCCTTGTCCCCCGTCTCAAGAGCATCTCCCCA
AATACCCGCCTCATTCTCTCCCGCCTCGTCCCCTTCGCCGCTGTCGCCTCCGCCTCCGCCCTGAACGTCTTCCTC
ATGCGCGGCAATGAGATCCGCCATGGCATTGACATCTACCCTGTCCTGTCAGAGGCCGAACGTGCTAAGCGCGAG
CTCGGTGAGCACGCAGAGCCAGTCCAAAGCATCGGCAAGAGCAAGAAGGCGGCTACCCTTGCCGTCGGTGAGACG
GCCATCTCCCGTGTCCTGAACGCTACGCCTATCATGGTCCTACCGCCGCTTATCCTCGTTCGTCTCGAGAAGACG
GACTGGCTGCGTGCCCGTCCCCGTATGGTTCTGCCTATTAACTTAGCGCTGATTCTGGGTACTTCGCTCTTCGCG
CTGCCGCTTGCGCTCGCTGCGTTCCCCGCTCGCCAGGCTATCAATGTTAAGAGCCTTGAGGAGGAGTTCCACGGT
CGTGGTGGTGACCTAGGCATGGTGGAGTTCAATCGCGGAATGTAA
Transcript >Pro_DTO377G3_2|g882.t1
ATGTCTGCCTCTCTCCCTGGCAGTCGGGACCTGCCTGCGTCGCCATATGACCTGAAGACCTATTGGGGTCGCGTG
CGCCATGCCGCCGACCTTTCTGATCCTCGGACTATGTTTGTTTCGTCCGCCGGGCTTGAAAACGCCAAGAACCTG
ATTGCTTCTTACAAGCAGAACCGCATCCCGGCCATGACACCGGAGTTGTGGTCGGCGAAGAAGATCGTTGATGCG
ACATTGCACCCTGATACTGGAATGCCCGTCTTCTTGCCTTTCCGCATGTCGTGCTACGTGCTCTCGAACTTGGTC
GTCACTGCAGGCATGCTGACTCCAGGATTGAAGACAACCGGAACCGTCCTCTGGCAAATCGGTAACCAATCCCTC
AATGTCGCCGTCAACAACGCAAACGCCAACAAATCTACCCCCCTCTCCATGTCGCAAATTGGCAAGTCATACCTC
CTGGCCGTCTCGGCCTCTTGCTCCGTCGCAGTCGGTCTGAACGCCCTTGTCCCCCGTCTCAAGAGCATCTCCCCA
AATACCCGCCTCATTCTCTCCCGCCTCGTCCCCTTCGCCGCTGTCGCCTCCGCCTCCGCCCTGAACGTCTTCCTC
ATGCGCGGCAATGAGATCCGCCATGGCATTGACATCTACCCTGTCCTGTCAGAGGCCGAACGTGCTAAGCGCGAG
CTCGGTGAGCACGCAGAGCCAGTCCAAAGCATCGGCAAGAGCAAGAAGGCGGCTACCCTTGCCGTCGGTGAGACG
GCCATCTCCCGTGTCCTGAACGCTACGCCTATCATGGTCCTACCGCCGCTTATCCTCGTTCGTCTCGAGAAGACG
GACTGGCTGCGTGCCCGTCCCCGTATGGTTCTGCCTATTAACTTAGCGCTGATTCTGGGTACTTCGCTCTTCGCG
CTGCCGCTTGCGCTCGCTGCGTTCCCCGCTCGCCAGGCTATCAATGTTAAGAGCCTTGAGGAGGAGTTCCACGGT
CGTGGTGGTGACCTAGGCATGGTGGAGTTCAATCGCGGAATGTAA
Gene >Pro_DTO377G3_2|g882.t1
ATGTCTGCCTCTCTCCCTGGCAGTCGGGACCTGCCTGCGTCGCCATATGACCTGAAGACCTATTGGGGTCGCGTG
CGCCATGCCGCCGACCTTTCTGATCCTCGGTAAGTTCAAATAGAAGATATTAGTGGCATTGAGAGATCCCCAGCA
TATACTGATCATACCAATTATGTTAGGACTATGTTTGTTTCGTCCGCCGGGCTTGAAAACGCCAAGAACCTGATT
GCTTCTTACAAGCAGAACCGCATCCCGGCCATGACACCGGAGTTGTGGTCGGCGAAGAAGATCGTTGATGCGACA
TTGCACCCTGGTATGGGCTCGTTCAATGTCAGGCAATAGCCATTGGCTAACTTATGACCGATCAGATACTGGAAT
GCCCGTCTTCTTGCCTTTCCGCATGTCGTGCTACGTGCTCTCGAACTTGGTCGTCACTGCAGGCATGCTGACTCC
AGGATTGAAGGTAAGCACCTCTGCATATGCAACATATGAACAACGTACTGACAATACAGACAACCGGAACCGTCC
TCTGGCAAATCGGTAACCAATCCCTCAATGTCGCCGTCAACAACGCAAACGCCAACAAATCTACCCCCCTCTCCA
TGTCGCAAATTGGCAAGTCATACCTCCTGGCCGTCTCGGCCTCTTGCTCCGTCGCAGTCGGTCTGAACGCCCTTG
TCCCCCGTCTCAAGAGCATCTCCCCAAATACCCGCCTCATTCTCTCCCGCCTCGTCCCCTTCGCCGCTGTCGCCT
CCGCCTCCGCCCTGAACGTCTTCCTCATGCGCGGCAATGAGATCCGCCATGGCATTGACATCTACCCTGTCCTGT
CAGAGGCCGAACGTGCTAAGCGCGAGCTCGGTGAGCACGCAGAGCCAGTCCAAAGCATCGGCAAGAGCAAGAAGG
CGGCTACCCTTGCCGTCGGTGAGACGGCCATCTCCCGTGTCCTGAACGCTACGCCTATCATGGTCCTACCGCCGC
TTATCCTCGTTCGTCTCGAGAAGACGGACTGGCTGCGTGCCCGTCCCCGTATGGTTCTGCCTATTAACTTAGCGC
TGATTCTGGGTACTTCGCTCTTCGCGCTGCCGCTTGCGCTCGCTGCGTTCCCCGCTCGCCAGGCTATCAATGTTA
AGAGCCTTGAGGAGGAGTTCCACGGTCGTGGTGGTGACCTAGGCATGGTGGAGTTCAATCGCGGAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail