Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8781.t1
Gene name
Locationscaffold_37:58668..60412
Strand-
Gene length (bp)1744
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00890 FAD_binding_2 FAD binding domain 5.0E-36 7 440
PF01266 DAO FAD dependent oxidoreductase 1.3E-10 7 94
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.1E-08 11 44
PF12831 FAD_oxidored FAD dependent oxidoreductase 6.4E-09 7 52
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.9E-07 7 189

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 9.75 4.17 15.33
5d_25C Five days - 25 degrees Celsius 18.50 9.30 27.70
7d_25C Seven days - 25 degrees Celsius 15.73 7.64 23.82
10d_25C Ten days - 25 degrees Celsius 22.32 11.80 32.83
7d_15C Seven days - 15 degrees Celsius 16.49 8.00 24.98
7d_30C Seven days - 30 degrees Celsius 15.95 7.61 24.29

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.028871 yes
3d_25C 7d_25C 0.123773 no
3d_25C 7d_15C 0.085819 no
3d_25C 7d_30C 0.116541 no
3d_25C 10d_25C 0.002761 yes
5d_25C 7d_25C 0.653586 no
5d_25C 7d_15C 0.765119 no
5d_25C 7d_30C 0.687438 no
5d_25C 10d_25C 0.574501 no
7d_25C 7d_15C 0.915467 no
7d_25C 7d_30C 0.975109 no
7d_25C 10d_25C 0.228836 no
7d_15C 7d_30C 0.940147 no
7d_15C 10d_25C 0.310764 no
7d_30C 10d_25C 0.256593 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8781.t1
MERIQVDVLVCGAGMSGMACAAFAAEAGAKVLVVEKQGDVGGSSNYSAGMFWAPQTYKKLRDWVPEGDPELQKAW
LSDYLPAVQWMRENGVPTADRFDGIMTIGIGFPIKIPHLHNLHRKRIQSSKTRSDIFTNTSVVKLIQKQPGVSGS
SILGAVICRNSPNSPAKYYEVRAKTVVLATGGFQGSPGMTSQYLGQGGDNIFVRSNRGSVGDGLKLAIESGAGTS
RGMNTYYGHLLAAPLRAEDVNPKDYLPLAQYQSKYCLLLNEAGRRFADETTGDEIINQYLAKQQKRRGFILFNEK
TRLQHCVTALFPNAGDIDRLQKAREHGCNVGSASTLSGLIDVLHAWGVNNVQARRTIEDYDQVVRLGNKSISLDA
PIGRACSPPAPLVDGEGPFYAMEVQPSITFTYGGIAIDAKGHALTPDKSRIPGLLVAGVDAGGFSNLGYAGGLAL
AFVTGLWAAREVARDLGLPEPRLPPPDLRDGEDKPIQGRL*
Coding >Pro_DTO377G3_2|g8781.t1
ATGGAGAGAATTCAAGTCGATGTCCTCGTCTGCGGGGCTGGCATGTCTGGAATGGCATGCGCTGCTTTTGCGGCG
GAAGCAGGAGCCAAAGTACTGGTCGTCGAAAAGCAAGGGGATGTTGGTGGTTCGTCAAATTATTCTGCAGGAATG
TTCTGGGCTCCACAGACATACAAAAAACTGAGAGACTGGGTCCCAGAAGGAGATCCAGAATTACAAAAGGCCTGG
TTAAGCGATTATCTACCGGCTGTACAGTGGATGCGTGAAAATGGGGTGCCAACAGCAGACCGGTTCGACGGCATC
ATGACAATCGGAATTGGATTCCCAATTAAAATCCCACACCTTCATAACCTCCATCGAAAGCGCATTCAGTCTAGC
AAGACACGTTCCGATATTTTCACCAACACGTCGGTGGTCAAGTTGATTCAGAAACAGCCCGGGGTTTCAGGGTCG
AGCATACTTGGCGCTGTCATTTGCAGGAACTCCCCCAATTCTCCAGCTAAATATTATGAAGTCCGAGCCAAAACG
GTGGTTTTGGCTACGGGAGGTTTCCAAGGTTCTCCGGGGATGACATCCCAATACTTGGGACAAGGTGGAGACAAC
ATTTTTGTGCGCTCCAATCGTGGATCGGTGGGCGATGGACTTAAGCTGGCCATCGAATCTGGTGCTGGGACTAGT
AGAGGAATGAATACCTACTATGGTCATCTTCTGGCAGCTCCTCTTCGAGCCGAAGACGTGAATCCAAAGGACTAT
CTTCCACTCGCCCAATACCAAAGCAAATACTGCCTACTGTTGAACGAGGCAGGTCGGCGATTTGCCGATGAGACC
ACGGGTGACGAGATCATCAATCAGTATCTCGCCAAGCAGCAAAAGCGCCGCGGGTTTATATTATTCAACGAGAAA
ACCCGTCTCCAACACTGCGTCACTGCGTTGTTCCCTAATGCAGGGGACATCGATCGTCTGCAGAAAGCCCGCGAA
CATGGCTGTAATGTTGGAAGTGCGTCGACATTGAGTGGTCTGATAGATGTTCTTCACGCCTGGGGTGTGAACAAT
GTACAGGCAAGACGGACTATCGAGGATTATGACCAAGTCGTGCGTTTAGGGAACAAGAGCATTTCCCTTGACGCA
CCTATTGGTCGTGCTTGTTCTCCCCCTGCACCATTGGTAGATGGGGAAGGTCCCTTCTATGCCATGGAGGTCCAG
CCGTCGATCACATTCACCTACGGCGGTATCGCGATCGATGCGAAAGGGCACGCCTTGACCCCCGATAAATCCAGA
ATTCCAGGCTTGCTTGTCGCGGGTGTCGATGCTGGCGGCTTCAGTAATCTCGGATACGCCGGGGGTCTTGCACTC
GCGTTCGTCACAGGACTATGGGCGGCCCGAGAGGTCGCACGCGACTTGGGGTTGCCTGAGCCTCGCCTACCCCCT
CCCGACCTTCGAGACGGGGAGGATAAACCAATCCAAGGGCGTCTTTGA
Transcript >Pro_DTO377G3_2|g8781.t1
ATGGAGAGAATTCAAGTCGATGTCCTCGTCTGCGGGGCTGGCATGTCTGGAATGGCATGCGCTGCTTTTGCGGCG
GAAGCAGGAGCCAAAGTACTGGTCGTCGAAAAGCAAGGGGATGTTGGTGGTTCGTCAAATTATTCTGCAGGAATG
TTCTGGGCTCCACAGACATACAAAAAACTGAGAGACTGGGTCCCAGAAGGAGATCCAGAATTACAAAAGGCCTGG
TTAAGCGATTATCTACCGGCTGTACAGTGGATGCGTGAAAATGGGGTGCCAACAGCAGACCGGTTCGACGGCATC
ATGACAATCGGAATTGGATTCCCAATTAAAATCCCACACCTTCATAACCTCCATCGAAAGCGCATTCAGTCTAGC
AAGACACGTTCCGATATTTTCACCAACACGTCGGTGGTCAAGTTGATTCAGAAACAGCCCGGGGTTTCAGGGTCG
AGCATACTTGGCGCTGTCATTTGCAGGAACTCCCCCAATTCTCCAGCTAAATATTATGAAGTCCGAGCCAAAACG
GTGGTTTTGGCTACGGGAGGTTTCCAAGGTTCTCCGGGGATGACATCCCAATACTTGGGACAAGGTGGAGACAAC
ATTTTTGTGCGCTCCAATCGTGGATCGGTGGGCGATGGACTTAAGCTGGCCATCGAATCTGGTGCTGGGACTAGT
AGAGGAATGAATACCTACTATGGTCATCTTCTGGCAGCTCCTCTTCGAGCCGAAGACGTGAATCCAAAGGACTAT
CTTCCACTCGCCCAATACCAAAGCAAATACTGCCTACTGTTGAACGAGGCAGGTCGGCGATTTGCCGATGAGACC
ACGGGTGACGAGATCATCAATCAGTATCTCGCCAAGCAGCAAAAGCGCCGCGGGTTTATATTATTCAACGAGAAA
ACCCGTCTCCAACACTGCGTCACTGCGTTGTTCCCTAATGCAGGGGACATCGATCGTCTGCAGAAAGCCCGCGAA
CATGGCTGTAATGTTGGAAGTGCGTCGACATTGAGTGGTCTGATAGATGTTCTTCACGCCTGGGGTGTGAACAAT
GTACAGGCAAGACGGACTATCGAGGATTATGACCAAGTCGTGCGTTTAGGGAACAAGAGCATTTCCCTTGACGCA
CCTATTGGTCGTGCTTGTTCTCCCCCTGCACCATTGGTAGATGGGGAAGGTCCCTTCTATGCCATGGAGGTCCAG
CCGTCGATCACATTCACCTACGGCGGTATCGCGATCGATGCGAAAGGGCACGCCTTGACCCCCGATAAATCCAGA
ATTCCAGGCTTGCTTGTCGCGGGTGTCGATGCTGGCGGCTTCAGTAATCTCGGATACGCCGGGGGTCTTGCACTC
GCGTTCGTCACAGGACTATGGGCGGCCCGAGAGGTCGCACGCGACTTGGGGTTGCCTGAGCCTCGCCTACCCCCT
CCCGACCTTCGAGACGGGGAGGATAAACCAATCCAAGGGCGTCTTTGA
Gene >Pro_DTO377G3_2|g8781.t1
ATGGAGAGAATTCAAGTCGATGTCCTCGTCTGCGGGGCTGGCATGTCTGGAATGGCATGCGCTGCTTTTGCGGCG
GAAGCAGGAGCCAAAGTACTGGTCGTCGAAAAGCAAGGGGATGTTGGTGGTTCGTCAAATTATTCTGCAGGAATG
TTGTACGTGATTGAATCAATCTTCAAGCCAAACTAGGTTGTTAATACATACTGTCAACGGACAGCTGGGCTCCAC
AGACATACAAAAAACTGAGAGACTGGGTCCCAGAAGGAGATCCAGAATTACAAAAGGCCTGGTTAAGCGATTATC
TACCGGCTGTACAGTGGATGCGTGAAAATGGGGTGCCAACAGCAGACCGGTTCGACGGCATCATGACAATCGGTA
AGGCTAAAAGAAAAAGAATTTAATGAACAGTGACCCTGACACATCATAGGAATTGGATTCCCAATTAAAATCCCA
CACCTTCATAACCTCCATCGAAAGCGCATTCAGTCTAGCAAGACACGTTCCGATATTTTCACCAACACGTCGGTG
GTCAAGTTGATTCAGAAACAGCCCGGGGTTTCAGGGTCGAGCATACTTGGCGCTGTCATTTGCAGGAACTCCCCC
AATTCTCCAGCTAAATATTATGAAGTCCGAGCCAAAACGGTGGTTTTGGCTACGGGAGGTTTCCAAGGTTCTCCG
GGGATGACATCCCAATACTTGGGACAAGGTGGAGACAACATTTTTGTGCGCTCCAATCGTGGATCGGTGGGCGAT
GGACTTAAGCTGGCCATCGAATCTGGTGCTGGGACTAGTAGAGGAATGAATACCTACTATGGTCATCTTCTGGCA
GCTCCTCTTCGAGCCGAAGACGTGAATCCAAAGGACTATCTTCCACTCGCCCAATACCGTAAGAGCAAGTCCTTG
TCAACTCAGCATTTCTCTCTAATCAGTCTACAGAAAGCAAATACTGCCTACTGTTGAACGAGGCAGGTCGGCGAT
TTGCCGATGAGACCACGGGTGACGAGATCATCAATCAGTATCTCGCCAAGCAGCAAAAGCGCCGCGGGTTTATAT
TATTCAAGTATGTCCCAGACAGAAAAAATTGGGGCGAAATTCTAACCTATGGCTTACTATTCTAGCGAGAAAACC
CGTCTCCAACACTGCGTCACTGCGTTGTTCCCTAATGCAGGGGACATCGATCGTCTGCAGAAAGCCCGCGAACAT
GGCTGTAATGTTGGAAGTGCGTCGACATTGAGTGGTCTGATAGATGTTCTTCACGCCTGGGGTGTGAACAATGTA
CAGGCAAGACGGACTATCGAGGATTATGACCAAGTCGTGCGTTTAGGGAACAAGAGCATTTCCCTTGACGCACCT
ATTGGTCGTGCTTGTTCTCCCCCTGCACCATTGGTAGATGGGGAAGGTCCCTTCTATGCCATGGAGGTCCAGCCG
TCGTAGGTTATATCTTACACAGTCCAGTTCCACCTATCTAATTTCCCATAGGATCACATTCACCTACGGCGGTAT
CGCGATCGATGCGAAAGGGCACGCCTTGACCCCCGATAAATCCAGAATTCCAGGCTTGCTTGTCGCGGGTGTCGA
TGCTGGCGGCTTCAGTAATCTCGGATACGCCGGGGGTCTTGCACTCGCGTTCGTCACAGGACTATGGGCGGCCCG
AGAGGTCGCACGCGACTTGGGGTTGCCTGAGCCTCGCCTACCCCCTCCCGACCTTCGAGACGGGGAGGATAAACC
AATCCAAGGGCGTCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail