Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8756.t1
Gene name
Locationscaffold_36:220023..220952
Strand-
Gene length (bp)929
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00462 Glutaredoxin Glutaredoxin 1.0E-17 197 261
PF00085 Thioredoxin Thioredoxin 9.5E-12 7 102

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0016491 oxidoreductase activity No
GO:0015035 protein-disulfide reductase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0015036 disulfide oxidoreductase activity No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 118.74 71.80 165.69
5d_25C Five days - 25 degrees Celsius 134.55 81.85 187.25
7d_25C Seven days - 25 degrees Celsius 134.06 81.36 186.77
10d_25C Ten days - 25 degrees Celsius 191.74 116.71 266.77
7d_15C Seven days - 15 degrees Celsius 113.02 67.93 158.11
7d_30C Seven days - 30 degrees Celsius 125.48 76.13 174.84

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.650583 no
3d_25C 7d_25C 0.662977 no
3d_25C 7d_15C 0.878467 no
3d_25C 7d_30C 0.862109 no
3d_25C 10d_25C 0.019353 yes
5d_25C 7d_25C 0.992250 no
5d_25C 7d_15C 0.503412 no
5d_25C 7d_30C 0.820050 no
5d_25C 10d_25C 0.105018 no
7d_25C 7d_15C 0.519033 no
7d_25C 7d_30C 0.831320 no
7d_25C 10d_25C 0.102131 no
7d_15C 7d_30C 0.719252 no
7d_15C 10d_25C 0.011062 yes
7d_30C 10d_25C 0.040807 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8756.t1
MSTLIEITSEADFSSHLSSLSPSALVVLYFHTPWAAPCAQMGAVLSALASQYPATTPPTISFVSINAEELPDISE
EYDVSAVPFVVCLRSGQILESISGSDAVKVRDAVERHAGRGNVAGAVGPMDGVKANIPPPLSAVAREDGPFTATQ
SPVTAAEPPSADAANATAVASAPTLTPEQSREALFARLEQLVNAASVMLFMKGTPSSPQCGFSRQLVGILRERSV
KYGFFNILADEDVRQGLKEYAEWPTFPQLWVNGELVGGLDIVREEINSDPDFLNDHSVNKPTAAA*
Coding >Pro_DTO377G3_2|g8756.t1
ATGTCGACACTCATCGAAATCACGTCTGAGGCCGACTTCTCCTCGCATCTTTCTTCCCTATCGCCGTCTGCATTA
GTTGTCCTATACTTCCATACTCCATGGGCAGCCCCGTGCGCGCAGATGGGCGCAGTACTCTCAGCCCTCGCTTCG
CAGTACCCCGCCACTACCCCGCCCACTATCTCGTTTGTCAGCATCAACGCCGAGGAGCTACCTGACATCTCGGAA
GAGTATGACGTTTCAGCCGTGCCGTTCGTTGTGTGCTTACGCAGCGGCCAAATATTAGAGTCGATCAGTGGAAGT
GATGCCGTCAAGGTTCGTGACGCTGTCGAGCGCCACGCTGGCCGCGGAAATGTCGCGGGTGCCGTCGGTCCGATG
GACGGTGTGAAAGCCAACATTCCTCCGCCGCTATCTGCTGTTGCTCGTGAGGATGGCCCCTTCACTGCTACTCAG
TCTCCTGTTACCGCTGCTGAGCCCCCTTCTGCTGATGCGGCTAATGCAACCGCCGTCGCGTCTGCCCCCACCCTG
ACACCCGAACAATCCCGGGAGGCACTATTTGCCCGCCTTGAGCAACTGGTCAACGCAGCATCTGTCATGCTGTTC
ATGAAAGGAACCCCGAGCAGCCCACAATGCGGATTCAGTCGGCAGCTGGTTGGAATTCTACGCGAGCGTAGTGTC
AAGTACGGCTTCTTCAATATCTTGGCCGATGAGGATGTGCGCCAGGGTCTGAAGGAGTACGCTGAGTGGCCAACT
TTCCCTCAATTGTGGGTGAACGGGGAATTGGTGGGTGGCTTGGATATTGTCCGTGAGGAAATCAACAGCGACCCC
GACTTCCTCAATGATCACTCAGTTAACAAACCCACCGCGGCTGCCTGA
Transcript >Pro_DTO377G3_2|g8756.t1
ATGTCGACACTCATCGAAATCACGTCTGAGGCCGACTTCTCCTCGCATCTTTCTTCCCTATCGCCGTCTGCATTA
GTTGTCCTATACTTCCATACTCCATGGGCAGCCCCGTGCGCGCAGATGGGCGCAGTACTCTCAGCCCTCGCTTCG
CAGTACCCCGCCACTACCCCGCCCACTATCTCGTTTGTCAGCATCAACGCCGAGGAGCTACCTGACATCTCGGAA
GAGTATGACGTTTCAGCCGTGCCGTTCGTTGTGTGCTTACGCAGCGGCCAAATATTAGAGTCGATCAGTGGAAGT
GATGCCGTCAAGGTTCGTGACGCTGTCGAGCGCCACGCTGGCCGCGGAAATGTCGCGGGTGCCGTCGGTCCGATG
GACGGTGTGAAAGCCAACATTCCTCCGCCGCTATCTGCTGTTGCTCGTGAGGATGGCCCCTTCACTGCTACTCAG
TCTCCTGTTACCGCTGCTGAGCCCCCTTCTGCTGATGCGGCTAATGCAACCGCCGTCGCGTCTGCCCCCACCCTG
ACACCCGAACAATCCCGGGAGGCACTATTTGCCCGCCTTGAGCAACTGGTCAACGCAGCATCTGTCATGCTGTTC
ATGAAAGGAACCCCGAGCAGCCCACAATGCGGATTCAGTCGGCAGCTGGTTGGAATTCTACGCGAGCGTAGTGTC
AAGTACGGCTTCTTCAATATCTTGGCCGATGAGGATGTGCGCCAGGGTCTGAAGGAGTACGCTGAGTGGCCAACT
TTCCCTCAATTGTGGGTGAACGGGGAATTGGTGGGTGGCTTGGATATTGTCCGTGAGGAAATCAACAGCGACCCC
GACTTCCTCAATGATCACTCAGTTAACAAACCCACCGCGGCTGCCTGA
Gene >Pro_DTO377G3_2|g8756.t1
ATGTCGACACTCATCGAAATCACGTCTGAGGCCGACTTCTCCTCGCATCTTTCTTCCCTATCGCCGTCTGCATTA
GTTGTCCTATACTTCCATACTCCATGGGCAGCCCCGTGCGCGCAGATGGGCGCAGTACTCTCAGCCCTCGCTTCG
CAGTACCCCGCCACTACCCCGCCCACTATCTCGTTTGTCAGCATCAACGCCGAGGAGCTACCTGACATCTCGGAA
GAGTATGACGTTTCAGCCGTGCCGTTCGTTGTGTGCTTACGCAGCGGCCAAATATTAGAGTCGATCAGTGGAAGT
GATGCCGTCAAGGTTCGTGACGCTGTCGAGCGCCACGCTGGCCGCGGAAATGTCGCGGGTGCCGTCGGTCCGATG
GACGGTGTGAAAGCCAACATTCCTCCGCCGCTATCTGCTGTTGCTCGTGAGGATGGCCCCTTCACTGCTACTCAG
TCTCCTGTTACCGCTGCTGAGCCCCCTTCTGCTGATGCGGCTAATGCAACCGCCGTCGCGTCTGCCCCCACCCTG
ACACCCGAACAATCCCGGGAGGCACTATTTGCCCGCCTTGAGCAACTGGTCAACGCAGCATCTGTCATGCTGTTC
ATGAAAGGAACCCCGAGCAGCCCACAATGCGGATTCAGTCGGCAGCTGGTTGGAATTCTACGCGAGCGTAGTGTC
AAGTACGGCTTCTTCAATATCTTGGCCGATGAGGATGTGCGCCAGGGTCTGAAGGAGTACGCTGAGTGGCCAACT
TTCCCTCAATTGTGGGTGAACGGGGAATTGGTGGGTGGCTTGGATATTGTACGTGTTCCGTCACACTCCACTTCT
TTGATTCGATTATTAACCCTATGGTATAGGTCCGTGAGGAAATCAACAGCGACCCCGACTTCCTCAATGATCACT
CAGTTAACAAACCCACCGCGGCTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail