Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8755.t1
Gene name
Locationscaffold_36:217933..219412
Strand+
Gene length (bp)1479
Transcript length (bp)1479
Coding sequence length (bp)1479
Protein length (aa) 493

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02668 TauD Taurine catabolism dioxygenase TauD, TfdA family 4.7E-47 216 455
PF06155 GBBH-like_N Gamma-butyrobetaine hydroxylase-like, N-terminal 2.3E-06 100 165

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 23.29 12.32 34.26
5d_25C Five days - 25 degrees Celsius 19.23 9.61 28.84
7d_25C Seven days - 25 degrees Celsius 16.08 7.74 24.41
10d_25C Ten days - 25 degrees Celsius 17.02 8.29 25.75
7d_15C Seven days - 15 degrees Celsius 19.13 9.51 28.74
7d_30C Seven days - 30 degrees Celsius 21.77 11.26 32.29

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.563061 no
3d_25C 7d_25C 0.196488 no
3d_25C 7d_15C 0.543561 no
3d_25C 7d_30C 0.864327 no
3d_25C 10d_25C 0.273843 no
5d_25C 7d_25C 0.616418 no
5d_25C 7d_15C 0.990640 no
5d_25C 7d_30C 0.736715 no
5d_25C 10d_25C 0.743571 no
7d_25C 7d_15C 0.623564 no
7d_25C 7d_30C 0.319915 no
7d_25C 10d_25C 0.893211 no
7d_15C 7d_30C 0.723264 no
7d_15C 10d_25C 0.755298 no
7d_30C 10d_25C 0.429436 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8755.t1
MHRLRASATFWQLPRALLYSTPRRNFIATPSRFNSPVEPDSHDKLESLAPGIDHPLPIPQDPSNSKGDVPDLTPE
VVTRKTHGNGILKVGKKESIWTGKEELYLHMDKYTTLKLPYTYLRDSCQCVVCKDQHSKQRSFRTSDIPKDIVPS
WVNWDGNKLSIRWDKDIGGSQTVHESTWARDFLKNPIFNTHDQHRSVNSKPIMWGQAKMEKSQHWVSYPDYITDN
SKLATAMHQLQRLGLIFVKDVPDSRSMVEAIATRMGPLRNTFYGSTFDVRTVPEATNVAYTNQFLGFHMDLMYMN
EPPGYQLLHCLQNSCSGGESLFADTFSAAKLMKEQYPKEYQVLSEQRLGYEYRHEDHIYYNERPVFEHDSDTDEL
RHVNYSPPFQSPLPNSHDAEHVNKLLDALAKFTSIIDNPNSIFELKLNPGDCVIFDNRRIVHARRQFNASVGSRW
LAGAYVDTDALLSRFAVCKNQHPYVWTKKAQKELAGNNSGNN*
Coding >Pro_DTO377G3_2|g8755.t1
ATGCATCGTCTCCGAGCTTCAGCTACCTTCTGGCAATTGCCAAGGGCCTTATTATACTCTACCCCGCGCCGTAAC
TTCATAGCTACCCCGAGTAGGTTCAACAGCCCCGTAGAGCCAGACTCTCACGACAAATTGGAATCTCTCGCCCCA
GGAATTGACCATCCACTTCCCATACCACAAGACCCCAGCAACTCTAAGGGGGACGTGCCAGACCTCACCCCCGAG
GTGGTGACAAGAAAAACCCATGGGAATGGCATCCTAAAAGTGGGCAAAAAAGAGTCGATCTGGACTGGAAAAGAG
GAATTGTACTTGCATATGGACAAATACACAACACTCAAATTGCCATATACTTACCTGCGCGATTCATGCCAGTGT
GTAGTGTGCAAGGATCAACACTCGAAGCAGCGCTCATTCCGCACAAGTGACATTCCCAAGGACATTGTTCCAAGC
TGGGTTAATTGGGATGGGAACAAGCTATCAATCCGGTGGGACAAAGACATTGGGGGGTCACAGACTGTACACGAA
TCAACCTGGGCCCGTGACTTTCTAAAGAATCCCATTTTCAACACTCATGATCAGCATCGGAGCGTGAACTCCAAA
CCGATCATGTGGGGACAGGCTAAAATGGAGAAAAGTCAACATTGGGTGTCTTACCCGGACTATATCACCGATAAT
TCCAAACTTGCCACTGCGATGCACCAGTTGCAGCGTCTGGGCCTTATTTTTGTGAAGGATGTTCCAGACTCACGA
TCGATGGTTGAAGCCATTGCAACACGAATGGGACCACTACGAAACACCTTCTACGGATCAACATTCGACGTGCGC
ACCGTCCCAGAGGCAACAAATGTCGCATATACAAACCAGTTCCTTGGGTTTCACATGGACTTGATGTATATGAAC
GAGCCACCCGGATACCAACTCCTCCACTGTCTGCAGAACTCCTGCTCGGGAGGCGAGTCACTGTTCGCCGACACA
TTTTCGGCCGCGAAACTCATGAAGGAGCAATACCCAAAAGAGTATCAAGTGCTAAGCGAGCAGCGGCTGGGGTAC
GAGTACAGGCACGAGGACCACATCTACTACAACGAACGACCCGTCTTTGAGCATGATTCCGACACAGACGAGCTG
CGCCATGTCAACTATTCGCCCCCCTTTCAGTCTCCCCTCCCGAATAGCCATGATGCTGAGCATGTGAACAAGCTA
CTAGATGCGCTTGCGAAGTTCACTTCGATTATTGATAATCCAAATAGCATCTTTGAGCTCAAGCTTAACCCGGGT
GATTGTGTCATCTTTGATAACAGAAGAATCGTTCATGCCCGCCGCCAATTCAATGCCAGCGTGGGGTCTCGATGG
TTAGCAGGCGCATATGTCGATACGGATGCTCTGCTATCCCGCTTTGCTGTCTGTAAGAATCAGCATCCGTATGTT
TGGACGAAAAAGGCACAGAAAGAGTTGGCGGGTAACAATAGTGGCAACAACTAG
Transcript >Pro_DTO377G3_2|g8755.t1
ATGCATCGTCTCCGAGCTTCAGCTACCTTCTGGCAATTGCCAAGGGCCTTATTATACTCTACCCCGCGCCGTAAC
TTCATAGCTACCCCGAGTAGGTTCAACAGCCCCGTAGAGCCAGACTCTCACGACAAATTGGAATCTCTCGCCCCA
GGAATTGACCATCCACTTCCCATACCACAAGACCCCAGCAACTCTAAGGGGGACGTGCCAGACCTCACCCCCGAG
GTGGTGACAAGAAAAACCCATGGGAATGGCATCCTAAAAGTGGGCAAAAAAGAGTCGATCTGGACTGGAAAAGAG
GAATTGTACTTGCATATGGACAAATACACAACACTCAAATTGCCATATACTTACCTGCGCGATTCATGCCAGTGT
GTAGTGTGCAAGGATCAACACTCGAAGCAGCGCTCATTCCGCACAAGTGACATTCCCAAGGACATTGTTCCAAGC
TGGGTTAATTGGGATGGGAACAAGCTATCAATCCGGTGGGACAAAGACATTGGGGGGTCACAGACTGTACACGAA
TCAACCTGGGCCCGTGACTTTCTAAAGAATCCCATTTTCAACACTCATGATCAGCATCGGAGCGTGAACTCCAAA
CCGATCATGTGGGGACAGGCTAAAATGGAGAAAAGTCAACATTGGGTGTCTTACCCGGACTATATCACCGATAAT
TCCAAACTTGCCACTGCGATGCACCAGTTGCAGCGTCTGGGCCTTATTTTTGTGAAGGATGTTCCAGACTCACGA
TCGATGGTTGAAGCCATTGCAACACGAATGGGACCACTACGAAACACCTTCTACGGATCAACATTCGACGTGCGC
ACCGTCCCAGAGGCAACAAATGTCGCATATACAAACCAGTTCCTTGGGTTTCACATGGACTTGATGTATATGAAC
GAGCCACCCGGATACCAACTCCTCCACTGTCTGCAGAACTCCTGCTCGGGAGGCGAGTCACTGTTCGCCGACACA
TTTTCGGCCGCGAAACTCATGAAGGAGCAATACCCAAAAGAGTATCAAGTGCTAAGCGAGCAGCGGCTGGGGTAC
GAGTACAGGCACGAGGACCACATCTACTACAACGAACGACCCGTCTTTGAGCATGATTCCGACACAGACGAGCTG
CGCCATGTCAACTATTCGCCCCCCTTTCAGTCTCCCCTCCCGAATAGCCATGATGCTGAGCATGTGAACAAGCTA
CTAGATGCGCTTGCGAAGTTCACTTCGATTATTGATAATCCAAATAGCATCTTTGAGCTCAAGCTTAACCCGGGT
GATTGTGTCATCTTTGATAACAGAAGAATCGTTCATGCCCGCCGCCAATTCAATGCCAGCGTGGGGTCTCGATGG
TTAGCAGGCGCATATGTCGATACGGATGCTCTGCTATCCCGCTTTGCTGTCTGTAAGAATCAGCATCCGTATGTT
TGGACGAAAAAGGCACAGAAAGAGTTGGCGGGTAACAATAGTGGCAACAACTAG
Gene >Pro_DTO377G3_2|g8755.t1
ATGCATCGTCTCCGAGCTTCAGCTACCTTCTGGCAATTGCCAAGGGCCTTATTATACTCTACCCCGCGCCGTAAC
TTCATAGCTACCCCGAGTAGGTTCAACAGCCCCGTAGAGCCAGACTCTCACGACAAATTGGAATCTCTCGCCCCA
GGAATTGACCATCCACTTCCCATACCACAAGACCCCAGCAACTCTAAGGGGGACGTGCCAGACCTCACCCCCGAG
GTGGTGACAAGAAAAACCCATGGGAATGGCATCCTAAAAGTGGGCAAAAAAGAGTCGATCTGGACTGGAAAAGAG
GAATTGTACTTGCATATGGACAAATACACAACACTCAAATTGCCATATACTTACCTGCGCGATTCATGCCAGTGT
GTAGTGTGCAAGGATCAACACTCGAAGCAGCGCTCATTCCGCACAAGTGACATTCCCAAGGACATTGTTCCAAGC
TGGGTTAATTGGGATGGGAACAAGCTATCAATCCGGTGGGACAAAGACATTGGGGGGTCACAGACTGTACACGAA
TCAACCTGGGCCCGTGACTTTCTAAAGAATCCCATTTTCAACACTCATGATCAGCATCGGAGCGTGAACTCCAAA
CCGATCATGTGGGGACAGGCTAAAATGGAGAAAAGTCAACATTGGGTGTCTTACCCGGACTATATCACCGATAAT
TCCAAACTTGCCACTGCGATGCACCAGTTGCAGCGTCTGGGCCTTATTTTTGTGAAGGATGTTCCAGACTCACGA
TCGATGGTTGAAGCCATTGCAACACGAATGGGACCACTACGAAACACCTTCTACGGATCAACATTCGACGTGCGC
ACCGTCCCAGAGGCAACAAATGTCGCATATACAAACCAGTTCCTTGGGTTTCACATGGACTTGATGTATATGAAC
GAGCCACCCGGATACCAACTCCTCCACTGTCTGCAGAACTCCTGCTCGGGAGGCGAGTCACTGTTCGCCGACACA
TTTTCGGCCGCGAAACTCATGAAGGAGCAATACCCAAAAGAGTATCAAGTGCTAAGCGAGCAGCGGCTGGGGTAC
GAGTACAGGCACGAGGACCACATCTACTACAACGAACGACCCGTCTTTGAGCATGATTCCGACACAGACGAGCTG
CGCCATGTCAACTATTCGCCCCCCTTTCAGTCTCCCCTCCCGAATAGCCATGATGCTGAGCATGTGAACAAGCTA
CTAGATGCGCTTGCGAAGTTCACTTCGATTATTGATAATCCAAATAGCATCTTTGAGCTCAAGCTTAACCCGGGT
GATTGTGTCATCTTTGATAACAGAAGAATCGTTCATGCCCGCCGCCAATTCAATGCCAGCGTGGGGTCTCGATGG
TTAGCAGGCGCATATGTCGATACGGATGCTCTGCTATCCCGCTTTGCTGTCTGTAAGAATCAGCATCCGTATGTT
TGGACGAAAAAGGCACAGAAAGAGTTGGCGGGTAACAATAGTGGCAACAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail