Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8752.t1
Gene name
Locationscaffold_36:210165..213029
Strand+
Gene length (bp)2864
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00924 MS_channel Mechanosensitive ion channel 4.7E-25 500 688

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 185 207 22
3 241 260 19
4 282 304 22
5 504 526 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8752.t1
MSSPVEERKAHIEDKDKRKHSDVSPPSNDGTYVTEPDADRDTGHLKVDTTHYEHDDDGHPPMRTPSARREQATRL
EDDLLVLQAERMTSHSTGAPDDEHDRNSIHRTRSRRSEAVDEFDEATNPLHEKAAIYKPPENPNTQFAVFVKKLH
QSSFLVRYLTYIAPIVLILLIPLLVGALRFPNASVGGVQLLWFSIWLEIVWLTLWAGRVAGKCLPPAVGLFASVF
TNNAKKWRDMAKQLEFHAALFFWWLGVEISFLPTMKNHHVDGDTGTKGWEITLNKIIIVIFVWTILNFIEKILIQ
LIAISFHMRTYADRIEINKFQIGSLSKLYDWSRSTLTEKDEAFEEKDDEPSSTGVKNPLHYAGLAHRKAKGALNK
VGNRVGDVAGAVVADVTGRATTRSTDAYQVILALLRTTGGCQVLARRLYRTFVRDGFETVFGGDLKAAFEDGEEA
EAAFAMFDRDMNGDISMEELEAVCVDIGRERKSITASLKDLDSVVSKLDNVFMFFVFVIVLIVFLSLISTSAAGV
LTSAGSAILALSWLFSATAQEFLQSVVFVFVKHPFDVGDRVTIYGNAGDSGLGDDYFVKEITLLYTEFKKMQGHV
VQAPNSYLNGLFILNQRRSGALAEAVPIIIKYGTSIDQLDSLRQRLLEFVRSEKRDFQSNILTEMRAVTENFSLT
LNIVFFYKSNWQNEGLRLQRRNKFICMLMVALQEIGIEGPRMNLQGAKFDIPFHVNYGNTRSAEQQAPIDADPVP
ISEESHHLPENTGSSSGSAIRHPSILRKGMNTANARARGPSVSQHKHVDFSLGMSNMASNDIMGDVFEDRGVVVG
EVVRSANRDAADRRIQEENEDEEERKSRTSSSRHRRPSNMSAPSNHDDGRRSTDAHSFRSGQSSLSRNRFFQHRS
SVGHDRDDLMEQGRVDEPTPPPPATVPGAKEHPY*
Coding >Pro_DTO377G3_2|g8752.t1
ATGTCGTCCCCCGTGGAGGAACGAAAAGCCCATATCGAAGACAAGGACAAGCGAAAACACTCGGACGTCTCTCCT
CCCTCCAATGATGGCACTTATGTGACCGAGCCTGACGCTGATCGCGACACGGGTCACTTGAAGGTCGACACTACA
CATTATGAGCATGATGATGATGGGCATCCGCCAATGCGCACCCCATCCGCCCGTCGGGAGCAGGCCACTCGTCTG
GAGGATGATTTGCTGGTCCTGCAGGCCGAGCGTATGACCTCGCATTCGACCGGCGCACCAGACGACGAACACGAT
CGCAATTCTATCCATCGCACCCGTTCGCGACGCTCCGAAGCCGTCGATGAGTTTGATGAAGCTACAAATCCCCTG
CACGAAAAGGCCGCAATTTACAAACCCCCGGAGAATCCAAACACCCAGTTTGCCGTCTTTGTGAAGAAACTCCAT
CAGTCGAGTTTCCTCGTGCGCTACTTGACCTACATTGCCCCCATTGTCCTCATTCTCTTGATCCCGTTGCTGGTC
GGCGCTCTCAGGTTTCCCAATGCCAGTGTCGGCGGTGTACAATTGCTGTGGTTTTCAATCTGGTTGGAAATTGTC
TGGTTGACTCTCTGGGCAGGACGGGTGGCTGGCAAGTGCTTGCCTCCAGCTGTCGGTCTTTTTGCGAGTGTCTTT
ACCAACAACGCCAAGAAATGGCGCGACATGGCGAAACAGCTCGAGTTTCACGCGGCGCTCTTTTTCTGGTGGCTT
GGCGTGGAGATCTCTTTCCTGCCAACGATGAAAAACCACCATGTGGATGGTGATACGGGGACCAAGGGATGGGAA
ATCACTCTTAACAAAATCATCATTGTCATCTTCGTGTGGACTATCCTGAATTTCATCGAAAAGATCCTCATCCAG
TTGATTGCCATCAGCTTCCATATGCGGACCTATGCGGACCGCATTGAGATCAACAAATTCCAGATTGGCAGTCTG
TCCAAGCTGTACGATTGGTCTCGGTCCACTCTTACTGAGAAAGATGAAGCATTTGAGGAGAAGGACGACGAACCG
AGTTCCACGGGAGTCAAGAACCCGTTGCACTATGCTGGCCTGGCCCACCGGAAGGCCAAGGGTGCCCTGAACAAA
GTTGGAAACCGGGTTGGCGATGTCGCAGGCGCGGTCGTCGCTGACGTCACTGGACGCGCGACGACTCGCAGCACC
GATGCCTATCAGGTCATTTTGGCGCTCCTGCGAACTACCGGAGGCTGTCAGGTCTTGGCGCGTCGTCTGTATCGC
ACCTTTGTGAGGGATGGCTTTGAGACCGTTTTTGGTGGTGACTTGAAAGCCGCATTTGAGGACGGCGAGGAAGCC
GAAGCTGCCTTCGCTATGTTTGATCGCGACATGAATGGTGATATTTCCATGGAGGAGCTGGAGGCCGTTTGCGTT
GACATTGGCCGTGAGCGCAAGTCCATTACTGCATCTCTCAAGGATTTGGATTCGGTTGTCTCGAAATTGGACAAT
GTCTTCATGTTCTTCGTGTTTGTGATTGTGCTGATTGTATTTTTGTCGCTCATCTCCACCTCAGCCGCCGGTGTG
CTCACATCCGCGGGCTCTGCTATTCTCGCACTGTCCTGGTTGTTCTCTGCTACTGCCCAAGAGTTCCTCCAGTCA
GTTGTCTTCGTCTTTGTCAAGCACCCCTTCGATGTTGGTGACCGTGTGACCATCTACGGTAACGCTGGAGATTCC
GGTCTTGGTGATGATTACTTTGTGAAGGAGATTACTCTTCTGTACACCGAGTTCAAGAAGATGCAAGGCCATGTC
GTGCAGGCCCCAAATAGCTACCTCAATGGCCTTTTCATCCTCAATCAGCGCCGTTCGGGCGCACTTGCCGAGGCG
GTTCCAATCATTATCAAGTATGGCACCAGCATCGACCAACTCGACTCCCTGCGCCAGCGCCTGTTGGAGTTTGTG
CGTAGCGAGAAACGCGACTTCCAGAGCAACATCCTCACCGAAATGCGTGCCGTCACCGAGAACTTTTCGCTCACA
CTCAACATCGTCTTCTTCTACAAGTCCAACTGGCAGAACGAGGGCCTACGTTTGCAGCGCCGCAACAAGTTCATA
TGTATGCTCATGGTCGCCCTCCAGGAAATCGGCATCGAGGGCCCACGCATGAACCTCCAAGGTGCCAAGTTCGAC
ATTCCGTTCCACGTCAACTATGGCAATACACGCTCTGCCGAGCAGCAAGCCCCTATCGATGCCGACCCAGTCCCC
ATCTCAGAAGAATCTCACCACCTGCCAGAGAATACCGGATCCAGCAGCGGCAGCGCTATCCGTCACCCATCGATT
CTTCGCAAGGGTATGAACACTGCCAATGCCCGTGCACGCGGCCCGTCTGTCTCACAGCACAAACACGTCGACTTC
TCCTTGGGCATGTCCAACATGGCATCCAACGATATTATGGGAGATGTGTTTGAGGATCGGGGTGTGGTCGTCGGT
GAAGTCGTCCGGTCGGCCAACCGCGATGCTGCAGACCGCCGCATCCAGGAAGAGAACGAGGACGAGGAGGAGCGC
AAGAGCCGTACATCTTCTTCCCGGCATCGTCGCCCCTCCAACATGAGCGCTCCCTCCAATCATGATGACGGTCGC
CGGTCGACCGACGCTCACAGCTTCCGTAGTGGCCAGTCATCGCTCAGCCGTAACCGGTTCTTCCAACACCGCAGC
AGCGTAGGTCACGATCGCGATGACTTGATGGAGCAAGGCCGCGTCGATGAGCCTACTCCTCCGCCACCGGCCACA
GTCCCTGGTGCCAAGGAGCACCCATATTGA
Transcript >Pro_DTO377G3_2|g8752.t1
ATGTCGTCCCCCGTGGAGGAACGAAAAGCCCATATCGAAGACAAGGACAAGCGAAAACACTCGGACGTCTCTCCT
CCCTCCAATGATGGCACTTATGTGACCGAGCCTGACGCTGATCGCGACACGGGTCACTTGAAGGTCGACACTACA
CATTATGAGCATGATGATGATGGGCATCCGCCAATGCGCACCCCATCCGCCCGTCGGGAGCAGGCCACTCGTCTG
GAGGATGATTTGCTGGTCCTGCAGGCCGAGCGTATGACCTCGCATTCGACCGGCGCACCAGACGACGAACACGAT
CGCAATTCTATCCATCGCACCCGTTCGCGACGCTCCGAAGCCGTCGATGAGTTTGATGAAGCTACAAATCCCCTG
CACGAAAAGGCCGCAATTTACAAACCCCCGGAGAATCCAAACACCCAGTTTGCCGTCTTTGTGAAGAAACTCCAT
CAGTCGAGTTTCCTCGTGCGCTACTTGACCTACATTGCCCCCATTGTCCTCATTCTCTTGATCCCGTTGCTGGTC
GGCGCTCTCAGGTTTCCCAATGCCAGTGTCGGCGGTGTACAATTGCTGTGGTTTTCAATCTGGTTGGAAATTGTC
TGGTTGACTCTCTGGGCAGGACGGGTGGCTGGCAAGTGCTTGCCTCCAGCTGTCGGTCTTTTTGCGAGTGTCTTT
ACCAACAACGCCAAGAAATGGCGCGACATGGCGAAACAGCTCGAGTTTCACGCGGCGCTCTTTTTCTGGTGGCTT
GGCGTGGAGATCTCTTTCCTGCCAACGATGAAAAACCACCATGTGGATGGTGATACGGGGACCAAGGGATGGGAA
ATCACTCTTAACAAAATCATCATTGTCATCTTCGTGTGGACTATCCTGAATTTCATCGAAAAGATCCTCATCCAG
TTGATTGCCATCAGCTTCCATATGCGGACCTATGCGGACCGCATTGAGATCAACAAATTCCAGATTGGCAGTCTG
TCCAAGCTGTACGATTGGTCTCGGTCCACTCTTACTGAGAAAGATGAAGCATTTGAGGAGAAGGACGACGAACCG
AGTTCCACGGGAGTCAAGAACCCGTTGCACTATGCTGGCCTGGCCCACCGGAAGGCCAAGGGTGCCCTGAACAAA
GTTGGAAACCGGGTTGGCGATGTCGCAGGCGCGGTCGTCGCTGACGTCACTGGACGCGCGACGACTCGCAGCACC
GATGCCTATCAGGTCATTTTGGCGCTCCTGCGAACTACCGGAGGCTGTCAGGTCTTGGCGCGTCGTCTGTATCGC
ACCTTTGTGAGGGATGGCTTTGAGACCGTTTTTGGTGGTGACTTGAAAGCCGCATTTGAGGACGGCGAGGAAGCC
GAAGCTGCCTTCGCTATGTTTGATCGCGACATGAATGGTGATATTTCCATGGAGGAGCTGGAGGCCGTTTGCGTT
GACATTGGCCGTGAGCGCAAGTCCATTACTGCATCTCTCAAGGATTTGGATTCGGTTGTCTCGAAATTGGACAAT
GTCTTCATGTTCTTCGTGTTTGTGATTGTGCTGATTGTATTTTTGTCGCTCATCTCCACCTCAGCCGCCGGTGTG
CTCACATCCGCGGGCTCTGCTATTCTCGCACTGTCCTGGTTGTTCTCTGCTACTGCCCAAGAGTTCCTCCAGTCA
GTTGTCTTCGTCTTTGTCAAGCACCCCTTCGATGTTGGTGACCGTGTGACCATCTACGGTAACGCTGGAGATTCC
GGTCTTGGTGATGATTACTTTGTGAAGGAGATTACTCTTCTGTACACCGAGTTCAAGAAGATGCAAGGCCATGTC
GTGCAGGCCCCAAATAGCTACCTCAATGGCCTTTTCATCCTCAATCAGCGCCGTTCGGGCGCACTTGCCGAGGCG
GTTCCAATCATTATCAAGTATGGCACCAGCATCGACCAACTCGACTCCCTGCGCCAGCGCCTGTTGGAGTTTGTG
CGTAGCGAGAAACGCGACTTCCAGAGCAACATCCTCACCGAAATGCGTGCCGTCACCGAGAACTTTTCGCTCACA
CTCAACATCGTCTTCTTCTACAAGTCCAACTGGCAGAACGAGGGCCTACGTTTGCAGCGCCGCAACAAGTTCATA
TGTATGCTCATGGTCGCCCTCCAGGAAATCGGCATCGAGGGCCCACGCATGAACCTCCAAGGTGCCAAGTTCGAC
ATTCCGTTCCACGTCAACTATGGCAATACACGCTCTGCCGAGCAGCAAGCCCCTATCGATGCCGACCCAGTCCCC
ATCTCAGAAGAATCTCACCACCTGCCAGAGAATACCGGATCCAGCAGCGGCAGCGCTATCCGTCACCCATCGATT
CTTCGCAAGGGTATGAACACTGCCAATGCCCGTGCACGCGGCCCGTCTGTCTCACAGCACAAACACGTCGACTTC
TCCTTGGGCATGTCCAACATGGCATCCAACGATATTATGGGAGATGTGTTTGAGGATCGGGGTGTGGTCGTCGGT
GAAGTCGTCCGGTCGGCCAACCGCGATGCTGCAGACCGCCGCATCCAGGAAGAGAACGAGGACGAGGAGGAGCGC
AAGAGCCGTACATCTTCTTCCCGGCATCGTCGCCCCTCCAACATGAGCGCTCCCTCCAATCATGATGACGGTCGC
CGGTCGACCGACGCTCACAGCTTCCGTAGTGGCCAGTCATCGCTCAGCCGTAACCGGTTCTTCCAACACCGCAGC
AGCGTAGGTCACGATCGCGATGACTTGATGGAGCAAGGCCGCGTCGATGAGCCTACTCCTCCGCCACCGGCCACA
GTCCCTGGTGCCAAGGAGCACCCATATTGA
Gene >Pro_DTO377G3_2|g8752.t1
ATGTCGTCCCCCGTGGAGGAACGAAAAGCCCATATCGAAGACAAGGACAAGCGAAAACACTCGGACGTCTCTCCT
CCCTCCAATGATGGCACTTATGTGACCGAGCCTGACGCTGATCGCGACACGGGTCACTTGAAGGTCGACACTACA
CATTATGAGCATGATGATGATGGGCATCCGCCAATGCGCACCCCATCCGCCCGTCGGGAGCAGGCCACTCGTCTG
GAGGATGATTTGCTGGTCCTGCAGGCCGAGCGTATGACCTCGCATTCGACCGGCGCACCAGACGACGAACACGAT
CGCAATTCTATCCATCGCACCCGTTCGCGACGCTCCGAAGCCGTCGATGAGTTTGATGAAGCTACAAATCCCCTG
CACGAAAAGGCCGCAATTTACAAACCCCCGGAGAATCCAAACACCCAGTTTGCCGTCTTTGTGAAGAAACTCCAT
CAGTCGAGTTTCCTCGTGCGCTACTTGACCTACATTGCCCCCATTGTCCTCATTCTCTTGATCCCGTTGCTGGTC
GGCGCTCTCAGGTTTCCCAATGCCAGTGTCGGCGGTGTACAATTGCTGTGGTTTTCAATCTGGTTGGAAATTGTC
TGGTTGACTCTCTGGGCAGGACGGGTGAGTCCAATCAATGAATCATTTCCCAACGAGCATTACTGATCTATTTCC
TTTCTTAGGTGGCTGGCAAGTGCTTGCCTCCAGCTGTCGGTCTTTTTGCGAGTGTCTTTACCAACAACGCCAAGA
AATGGCGCGACATGGCGAAACAGCTCGAGTTTCACGCGGCGCTCTTTTTCTGGTGGCTTGGCGTGGAGATCTCTT
TCCTGCCAACGATGAAAAACCACCATGTGGATGGTGATACGGGGACCAAGGGATGGGAAATCACTCTTAACAAAA
TCATCATTGTCATCTTCGTGTGGACTATCCTGAATTTCATCGAAAAGATCCTCATCCAGTTGATTGCCATCAGCT
TCCATATGCGGACCTATGCGGACCGCATTGAGATCAACAAATTCCAGATTGGCAGTCTGTCCAAGCTGTACGATT
GGTCTCGGTCCACTCTTACTGAGAAAGATGAAGCATTTGAGGAGAAGGACGACGAACCGAGTTCCACGGGAGTCA
AGAACCCGTTGCACTATGCTGGCCTGGCCCACCGGAAGGCCAAGGGTGCCCTGAACAAAGTTGGAAACCGGGTTG
GCGATGTCGCAGGCGCGGTCGTCGCTGACGTCACTGGACGCGCGACGACTCGCAGCACCGATGCCTATCAGGTCA
TTTTGGCGCTCCTGCGAACTACCGGAGGCTGTCAGGTCTTGGCGCGTCGTCTGTATCGCACCTTTGTGAGGGATG
GCTTTGAGACCGTTTTTGGTGGTGACTTGAAAGCCGCATTTGAGGACGGCGAGGAAGCCGAAGCTGCCTTCGCTA
TGTTTGATCGCGACATGAATGGTGATATTTCCATGGAGGAGCTGGAGGCCGTTTGCGTTGACATTGGCCGTGAGC
GCAAGTCCATTACTGCATCTCTCAAGGATTTGGATTCGGTTGTCTCGAAATTGGACAATGTCTTCATGTTCTTCG
TGTTTGTGATTGTGCTGATTGTATTTTTGTCGCTCATCTCCACCTCAGCCGCCGGTGTGCTCACATCCGCGGGCT
CTGCTATTCTCGCACTGTCCTGGTTGTTCTCTGCTACTGCCCAAGAGTTCCTCCAGTCAGTTGTCTTCGTCTTTG
TCAAGCACCCCTTCGATGTTGGTGACCGTGTGACCATCTACGGTAACGCTGGAGATTCCGGTCTTGGTGATGATT
ACTTTGTGAAGGAGATTACTCTTCTGTACACCGAGTTCAAGAAGATGCAAGGCCATGTCGTGCAGGCCCCAAATA
GCTACCTCAATGGCCTTTTCATCCTCAATCAGCGCCGTTCGGGCGCACTTGCCGAGGCGGTTCCAATCATTATCA
AGTATGGCACCAGCATCGACCAACTCGACTCCCTGCGCCAGCGCCTGTTGGAGTTTGTGCGTAGCGAGAAACGCG
ACTTCCAGAGCAACATCCTCACCGAAATGCGTGCCGTCACCGAGAACTTTTCGCTCACACTCAACATCGTCTTCT
TCTACAAGTCCAACTGGCAGAACGAGGGCCTACGTTTGCAGCGCCGCAACAAGTTCATATGTATGCTCATGGTCG
CCCTCCAGGAAATCGGCATCGAGGGCCCACGCATGAACCTCCAAGGTGCCAAGTTCGACATTCCGTTCCACGTCA
ACTATGGCAATACACGCTCTGCCGAGCAGCAAGCCCCTATCGATGCCGACCCAGTCCCCATCTCAGAAGAATCTC
ACCACCTGCCAGAGAATACCGGATCCAGCAGCGGCAGCGCTATCCGTCACCCATCGATTCTTCGCAAGGGTATGA
ACACTGCCAATGCCCGTGCACGCGGCCCGTCTGTCTCACAGCACAAACACGTCGACTTCTCCTTGGGCATGTCCA
ACATGGCATCCAACGATATTATGGGAGATGTGTTTGAGGATCGGGGTGTGGTCGTCGGTGAAGTCGTCCGGTCGG
CCAACCGCGATGCTGCAGACCGCCGCATCCAGGAAGAGAACGAGGACGAGGAGGAGCGCAAGAGCCGTACATCTT
CTTCCCGGCATCGTCGCCCCTCCAACATGAGCGCTCCCTCCAATCATGATGACGGTCGCCGGTCGACCGACGCTC
ACAGCTTCCGTAGTGGCCAGTCATCGCTCAGCCGTAACCGGTTCTTCCAACACCGCAGCAGCGTAGGTCACGATC
GCGATGACTTGATGGAGCAAGGCCGCGTCGATGAGCCTACTCCTCCGCCACCGGCCACAGTCCCTGGTGCCAAGG
AGCACCCATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail