Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8745.t1
Gene name
Locationscaffold_36:187589..188399
Strand+
Gene length (bp)810
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 3.4E-11 158 192
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 2.4E-02 101 136
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 3.8E-10 157 192
PF12464 Mac Maltose acetyltransferase 1.6E-12 29 85

GO

GO Term Description Terminal node
GO:0016407 acetyltransferase activity Yes
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups No
GO:0003824 catalytic activity No
GO:0016746 transferase activity, transferring acyl groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8745.t1
MAASEKRPEIIELARGLARVPLCEDYECMISGMMYNPNIPKLLEARHLCRGLAADFNNLDTKTVTYDKIGDKRLE
LLRKLVGKIGDGTFIEPPFLPDYGCNTSIGKDCFFNWNLTILDTSLVVIGDRVQIGTGVSLITAGHDTSVLSRRK
FVEFGHPIFIEDDCWIGSNVIVLPGVRIGQGSTIGAGSVVTKDIPPFSVAVGTPCRVKKTIQSAEEEEQDPNNPY
RSLVREDQ*
Coding >Pro_DTO377G3_2|g8745.t1
ATGGCTGCCTCTGAGAAACGCCCTGAGATCATCGAGCTTGCTCGGGGACTGGCAAGAGTGCCCTTGTGCGAGGAC
TATGAGTGTATGATATCTGGGATGATGTACAACCCCAACATCCCGAAATTGCTAGAGGCGCGGCATTTATGTCGG
GGACTTGCTGCAGACTTCAACAATCTGGACACAAAGACCGTGACGTATGACAAGATCGGCGACAAGCGTCTTGAG
TTATTGCGGAAACTTGTCGGCAAAATTGGAGATGGAACATTCATTGAACCACCATTTTTGCCAGACTACGGATGC
AATACTTCGATCGGAAAGGATTGCTTCTTCAACTGGAACCTTACGATACTGGACACCAGTCTAGTTGTCATCGGT
GACCGTGTACAGATTGGCACTGGAGTTAGTCTCATCACCGCTGGCCATGATACTAGCGTTCTTTCTCGCCGTAAA
TTCGTCGAGTTTGGCCATCCGATCTTTATCGAAGACGACTGCTGGATTGGAAGTAATGTGATTGTTCTGCCCGGT
GTGCGAATCGGCCAGGGCTCAACAATTGGAGCCGGATCTGTTGTCACCAAGGATATCCCGCCGTTCTCTGTCGCC
GTTGGCACTCCTTGCCGCGTGAAGAAGACAATTCAATCGGCGGAAGAAGAGGAGCAGGATCCTAATAATCCGTAC
CGCAGTTTGGTTCGTGAGGATCAATAG
Transcript >Pro_DTO377G3_2|g8745.t1
ATGGCTGCCTCTGAGAAACGCCCTGAGATCATCGAGCTTGCTCGGGGACTGGCAAGAGTGCCCTTGTGCGAGGAC
TATGAGTGTATGATATCTGGGATGATGTACAACCCCAACATCCCGAAATTGCTAGAGGCGCGGCATTTATGTCGG
GGACTTGCTGCAGACTTCAACAATCTGGACACAAAGACCGTGACGTATGACAAGATCGGCGACAAGCGTCTTGAG
TTATTGCGGAAACTTGTCGGCAAAATTGGAGATGGAACATTCATTGAACCACCATTTTTGCCAGACTACGGATGC
AATACTTCGATCGGAAAGGATTGCTTCTTCAACTGGAACCTTACGATACTGGACACCAGTCTAGTTGTCATCGGT
GACCGTGTACAGATTGGCACTGGAGTTAGTCTCATCACCGCTGGCCATGATACTAGCGTTCTTTCTCGCCGTAAA
TTCGTCGAGTTTGGCCATCCGATCTTTATCGAAGACGACTGCTGGATTGGAAGTAATGTGATTGTTCTGCCCGGT
GTGCGAATCGGCCAGGGCTCAACAATTGGAGCCGGATCTGTTGTCACCAAGGATATCCCGCCGTTCTCTGTCGCC
GTTGGCACTCCTTGCCGCGTGAAGAAGACAATTCAATCGGCGGAAGAAGAGGAGCAGGATCCTAATAATCCGTAC
CGCAGTTTGGTTCGTGAGGATCAATAG
Gene >Pro_DTO377G3_2|g8745.t1
ATGGCTGCCTCTGAGAAACGCCCTGAGATCATCGAGCTTGCTCGGGGACTGGCAAGAGTGCCCTTGTGCGAGGAC
TATGAGTGTATGATATCTGGGATGATGTGTGTATCATTTAAATCCTTACACTTTGACGGGACAGACTGTTGACCT
GTCTAGGTACAACCCCAACATCCCGAAATTGCTAGAGGCGCGGCATTTATGTCGGGGACTTGCTGCAGACTTCAA
CAATCTGGACACAAAGACCGTGACGTATGACAAGATCGGCGACAAGCGTCTTGAGTTATTGCGGAAACTTGTCGG
CAAAATTGGAGATGGAACATTCATTGAACCACCATTTTTGCCAGACTACGGATGCAATACTTCGATCGGAAAGGA
TTGCTTCTTCAACTGGAAGTGAGTCTTCATTTCCAACCTATGTCTTGTTGAAACTTGCTAACAATTCCTAGCCTT
ACGATACTGGACACCAGTCTAGTTGTCATCGGTGACCGTGTACAGATTGGCACTGGAGTTAGTCTCATCACCGCT
GGCCATGATACTAGCGTTCTTTCTCGCCGTAAATTCGTCGAGTTTGGCCATCCGATCTTTATCGAAGACGACTGC
TGGATTGGAAGTAATGTGATTGTTCTGCCCGGTGTGCGAATCGGCCAGGGCTCAACAATTGGAGCCGGATCTGTT
GTCACCAAGGATATCCCGCCGTTCTCTGTCGCCGTTGGCACTCCTTGCCGCGTGAAGAAGACAATTCAATCGGCG
GAAGAAGAGGAGCAGGATCCTAATAATCCGTACCGCAGTTTGGTTCGTGAGGATCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail