Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8741.t1
Gene name
Locationscaffold_36:178094..179874
Strand+
Gene length (bp)1780
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00179 UQ_con Ubiquitin-conjugating enzyme 3.8E-31 8 156
PF00179 UQ_con Ubiquitin-conjugating enzyme 1.7E-05 313 383
PF05743 UEV UEV domain 2.0E-04 56 104

GO

GO Term Description Terminal node
GO:0015031 protein transport Yes
GO:0006464 cellular protein modification process Yes
GO:0043170 macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051179 localization No
GO:0042886 amide transport No
GO:0071702 organic substance transport No
GO:0051234 establishment of localization No
GO:0008104 protein localization No
GO:0071704 organic substance metabolic process No
GO:0045184 establishment of protein localization No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0071705 nitrogen compound transport No
GO:0015833 peptide transport No
GO:0033036 macromolecule localization No
GO:0006810 transport No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044267 cellular protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043412 macromolecule modification No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8741.t1
MGDQCTLRLVRELRQVEQSEQLAFTIYYEESNIRDIQALIIGPPGTPYELGFYEFSIRIPSDYPANPPVVKIRTT
NRGRTRFGPNLYANGKVCLSILGTWHGSRGEQWSPAQGLESVLLSIQSLLSSNPYTLEPGFDDNERANDTENMEI
YKSKIRHENLRLAVITPVEQAFQTATPPRRTAPRVGWESSTEEDSDHELQLDLDGFPIQSKFGDFCKRRFLWYFE
FYQNAIEKGIADEARRQGTPFIQMPFEGYGNSMGGEWNYIALQARLLAVRDQVMEETNRWAIEGLTLVKEDAGIA
VKLRGRHEQIAAEMNSSPQVIDLSLVDDNPFVWRLTYVGRNESKLEGGIIKIKIHISPRHPEEQPRVFIEPPLYH
ICVSKMGVLMYLPSHAEEIGQHIDGIINTLEEDNPPYNPLMTVNPEATALCWGSELERRLYRRKLRASLEDS*
Coding >Pro_DTO377G3_2|g8741.t1
ATGGGTGACCAGTGCACTCTGCGCCTCGTCCGAGAGTTGAGACAGGTCGAGCAAAGTGAACAACTGGCCTTCACT
ATCTACTACGAAGAAAGCAACATTCGGGATATCCAGGCCCTCATCATCGGACCCCCGGGCACCCCATACGAACTG
GGCTTTTACGAGTTCTCGATCAGGATCCCATCAGATTACCCAGCAAATCCCCCGGTGGTGAAAATCCGGACGACC
AACAGGGGCCGAACTCGCTTTGGACCTAATCTGTATGCTAATGGGAAGGTCTGCTTGTCGATCTTGGGAACTTGG
CATGGTTCCCGAGGTGAGCAATGGTCGCCTGCACAGGGACTCGAGTCCGTTCTGCTGTCAATCCAGAGCCTGTTA
TCATCAAACCCGTATACGCTGGAACCGGGATTTGACGACAACGAACGGGCGAACGACACGGAAAATATGGAGATC
TACAAGTCCAAGATTCGTCATGAGAATCTACGACTAGCAGTCATTACACCGGTTGAACAAGCCTTCCAAACTGCG
ACGCCTCCCCGCCGAACGGCGCCAAGGGTTGGTTGGGAGTCTAGCACGGAAGAAGATAGTGATCACGAACTCCAA
CTCGATCTAGACGGATTCCCCATTCAAAGCAAGTTTGGCGACTTTTGCAAGCGACGGTTCCTATGGTACTTCGAG
TTCTACCAGAACGCTATTGAGAAAGGTATCGCGGACGAGGCACGCAGACAAGGAACGCCCTTCATCCAAATGCCG
TTTGAAGGCTATGGCAATTCCATGGGCGGAGAATGGAACTACATCGCCCTACAAGCCCGTTTGTTGGCTGTCCGA
GACCAGGTAATGGAAGAGACAAACCGCTGGGCCATCGAGGGTCTTACTCTGGTCAAGGAGGATGCTGGGATTGCC
GTTAAACTTCGGGGTCGGCATGAACAGATTGCTGCAGAAATGAACAGTTCTCCTCAAGTTATCGATCTGTCACTG
GTTGATGATAACCCGTTCGTCTGGAGACTCACCTATGTTGGTCGCAACGAGTCCAAGTTGGAAGGTGGCATCATC
AAGATCAAGATTCACATCTCTCCCCGACACCCAGAAGAACAGCCTCGGGTCTTTATCGAGCCGCCCCTGTACCAC
ATTTGTGTCTCCAAAATGGGTGTGTTGATGTATCTTCCTTCGCATGCTGAAGAGATCGGCCAACATATCGACGGC
ATCATCAATACACTGGAAGAAGACAACCCCCCGTACAATCCCCTCATGACAGTGAACCCAGAGGCAACCGCTCTG
TGCTGGGGTTCGGAACTAGAGCGCAGGCTTTACAGACGCAAGCTTCGAGCATCACTAGAGGATTCCTGA
Transcript >Pro_DTO377G3_2|g8741.t1
ATGGGTGACCAGTGCACTCTGCGCCTCGTCCGAGAGTTGAGACAGGTCGAGCAAAGTGAACAACTGGCCTTCACT
ATCTACTACGAAGAAAGCAACATTCGGGATATCCAGGCCCTCATCATCGGACCCCCGGGCACCCCATACGAACTG
GGCTTTTACGAGTTCTCGATCAGGATCCCATCAGATTACCCAGCAAATCCCCCGGTGGTGAAAATCCGGACGACC
AACAGGGGCCGAACTCGCTTTGGACCTAATCTGTATGCTAATGGGAAGGTCTGCTTGTCGATCTTGGGAACTTGG
CATGGTTCCCGAGGTGAGCAATGGTCGCCTGCACAGGGACTCGAGTCCGTTCTGCTGTCAATCCAGAGCCTGTTA
TCATCAAACCCGTATACGCTGGAACCGGGATTTGACGACAACGAACGGGCGAACGACACGGAAAATATGGAGATC
TACAAGTCCAAGATTCGTCATGAGAATCTACGACTAGCAGTCATTACACCGGTTGAACAAGCCTTCCAAACTGCG
ACGCCTCCCCGCCGAACGGCGCCAAGGGTTGGTTGGGAGTCTAGCACGGAAGAAGATAGTGATCACGAACTCCAA
CTCGATCTAGACGGATTCCCCATTCAAAGCAAGTTTGGCGACTTTTGCAAGCGACGGTTCCTATGGTACTTCGAG
TTCTACCAGAACGCTATTGAGAAAGGTATCGCGGACGAGGCACGCAGACAAGGAACGCCCTTCATCCAAATGCCG
TTTGAAGGCTATGGCAATTCCATGGGCGGAGAATGGAACTACATCGCCCTACAAGCCCGTTTGTTGGCTGTCCGA
GACCAGGTAATGGAAGAGACAAACCGCTGGGCCATCGAGGGTCTTACTCTGGTCAAGGAGGATGCTGGGATTGCC
GTTAAACTTCGGGGTCGGCATGAACAGATTGCTGCAGAAATGAACAGTTCTCCTCAAGTTATCGATCTGTCACTG
GTTGATGATAACCCGTTCGTCTGGAGACTCACCTATGTTGGTCGCAACGAGTCCAAGTTGGAAGGTGGCATCATC
AAGATCAAGATTCACATCTCTCCCCGACACCCAGAAGAACAGCCTCGGGTCTTTATCGAGCCGCCCCTGTACCAC
ATTTGTGTCTCCAAAATGGGTGTGTTGATGTATCTTCCTTCGCATGCTGAAGAGATCGGCCAACATATCGACGGC
ATCATCAATACACTGGAAGAAGACAACCCCCCGTACAATCCCCTCATGACAGTGAACCCAGAGGCAACCGCTCTG
TGCTGGGGTTCGGAACTAGAGCGCAGGCTTTACAGACGCAAGCTTCGAGCATCACTAGAGGATTCCTGA
Gene >Pro_DTO377G3_2|g8741.t1
ATGGGTGACCAGTGCACTCTGCGCCTCGTCCGAGTACGTGCCTTTCCAACTATGATTCATTTGGGCAAATTAACC
CGATAAAAACACTAATCTCTCATTGTCGCCTTAGGAGTTGAGACAGGTCGAGCAAAGTGAACAACTGGGTATGAG
ATCTCTTAGCACTTCAAGCCATTCCGTATGGAGACCCACAGACTGACCTCGATACAGCCTTCACTATCTACTACG
AAGAAAGCAACATTCGGGATATCCAGGCCCTCATCATCGGACCCCCGGGCACCCCATACGAACTGGGCTTTTACG
AGGTGAGATCCACCCAGCTATTCAAGGCGGGCCCGGGCACGCTTGTTGAACTATGACTAACCAATTGTAATCGTC
TGCCAGTTCTCGATCAGGATCCCATCAGGTAAGATGATCTTGTCTTTCATGGCAGGTCCTTGCTAAATCATATGG
TGATAGATTACCCAGCAAATCCCCCGGTGGTGAAAATCCGGACGACCAACAGGGGCCGAACTCGCTTTGGACCTA
ATCTGTATGCTAATGGGAAGGTCTGCTTGTAAGTGTACCCGGATACTTCTTTTATACAACGCCTGATACTAACAT
TTTCTAGGTCGATCTTGGGGTAAGCTTGTCTAACAATAGAGGGTTTTTATGGAGCATCGCTAAACATCGCAACAG
AACTTGGCATGGTTCCCGAGGTGAGCAATGGTCGCCTGCACAGGGACTCGAGTCCGTTCTGCTGTCAATCCAGAG
CCTGTTATCATCAAACCCGTATACGCTGGAACCGGGATTTGACGACAACGAACGGGCGAACGACACGGAAAATAT
GGAGATCTACAAGTCCAAGGTAAAGATCGCTATCTTGTCAGAATAAACTGGACAATGCTCACATTTATATCAGAT
TCGTCATGAGAATCTACGACTAGCAGTCATTACACCGGTTGAACAAGCCTTCCAAACTGCGACGCCTCCCCGCCG
AACGGCGCCAAGGGTTGGTTGGGAGTCTAGCACGGAAGAAGATAGTGATCACGAACTCCAACTCGATCTAGACGG
ATTCCCCATTCAAAGCAAGTTTGGCGACTTTTGCAAGCGACGGTTCCTATGGTACTTCGAGTTCTACCAGAACGC
TATTGAGAAAGGTATCGCGGACGAGGCACGCAGACAAGGAACGCCCTTCATCCAAATGCCGTTTGAAGGCTATGG
CAATTCCATGGGCGGAGAATGGAACTACATCGCCCTACAAGCCCGTTTGTTGGCTGTCCGAGACCAGGTAATGGA
AGAGACAAACCGCTGGGCCATCGAGGGTCTTACTCTGGTCAAGGAGGATGCTGGGATTGCCGTTAAACTTCGGGG
TCGGCATGAACAGATTGCTGCAGAAATGAACAGTTCTCCTCAAGTTATCGATCTGTCACTGGTTGATGATAACCC
GTTCGTCTGGAGACTCACCTATGTTGGTCGCAACGAGTCCAAGTTGGAAGGTGGCATCATCAAGATCAAGATTCA
CATCTCTCCCCGACACCCAGAAGAACAGCCTCGGGTCTTTATCGAGCCGCCCCTGTACCACATTTGTGTCTCCAA
AATGGGTGTGTTGATGTATCTTCCTTCGCATGCTGAAGAGATCGGCCAACATATCGACGGCATCATCAATACACT
GGAAGAAGACAACCCCCCGTACAATCCCCTCATGACAGTGAACCCAGAGGCAACCGCTCTGTGCTGGGGTTCGGA
ACTAGAGCGCAGGCTTTACAGACGCAAGCTTCGAGCATCACTAGAGGATTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail