Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8736.t1
Gene name
Locationscaffold_36:166963..167889
Strand+
Gene length (bp)926
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04099 Sybindin Sybindin-like family 4.5E-46 28 186
PF04628 Sedlin_N Sedlin, N-terminal conserved region 2.6E-06 118 181

GO

GO Term Description Terminal node
GO:0030008 TRAPP complex Yes
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0016192 vesicle-mediated transport Yes
GO:0005622 intracellular Yes
GO:0006810 transport No
GO:0044464 cell part No
GO:0099023 tethering complex No
GO:0051179 localization No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0046907 intracellular transport No
GO:0044424 intracellular part No
GO:0048193 Golgi vesicle transport No
GO:0051641 cellular localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8736.t1
MRLGHSRPPPLASPAALSVPATQLTMGVFSLIIINKAGGLIYQREFQSGLRNLSTNDYLVLAGTFHGVHAITRSI
TPKIPIAQPAPSTTSTGTAAPAASGYSYPNPGVPVSGLDYLETDKFRLTCFQTLTGTKFLLFTDPLTGGVDAIIQ
RIYELYADYVMKNPFYQIEMPVRCEAFDRHLGAWLRGRT*
Coding >Pro_DTO377G3_2|g8736.t1
ATGCGACTTGGCCATTCACGCCCTCCGCCCCTTGCTTCTCCGGCCGCGCTGTCCGTACCAGCGACTCAACTCACC
ATGGGCGTCTTCTCCCTGATCATTATCAACAAAGCCGGGGGCCTCATCTACCAGCGCGAGTTTCAATCTGGTTTG
CGCAACCTCTCGACAAATGACTACCTCGTCCTAGCTGGAACCTTTCACGGCGTTCACGCGATCACCCGCTCCATC
ACACCGAAAATTCCCATCGCCCAACCTGCTCCCTCTACAACCTCAACGGGCACCGCCGCTCCTGCTGCGTCCGGT
TACTCCTACCCAAACCCCGGTGTACCAGTCTCCGGCTTGGATTACCTCGAGACCGACAAGTTTCGATTGACATGT
TTCCAGACCTTGACGGGGACGAAGTTCTTGTTGTTCACGGATCCGTTGACGGGCGGCGTGGACGCAATCATTCAG
AGGATCTATGAGCTCTATGCCGACTATGTGATGAAGAATCCATTCTATCAGATTGAGATGCCGGTGCGATGCGAG
GCATTCGATCGGCATCTGGGCGCATGGTTGAGGGGGAGGACATAG
Transcript >Pro_DTO377G3_2|g8736.t1
ATGCGACTTGGCCATTCACGCCCTCCGCCCCTTGCTTCTCCGGCCGCGCTGTCCGTACCAGCGACTCAACTCACC
ATGGGCGTCTTCTCCCTGATCATTATCAACAAAGCCGGGGGCCTCATCTACCAGCGCGAGTTTCAATCTGGTTTG
CGCAACCTCTCGACAAATGACTACCTCGTCCTAGCTGGAACCTTTCACGGCGTTCACGCGATCACCCGCTCCATC
ACACCGAAAATTCCCATCGCCCAACCTGCTCCCTCTACAACCTCAACGGGCACCGCCGCTCCTGCTGCGTCCGGT
TACTCCTACCCAAACCCCGGTGTACCAGTCTCCGGCTTGGATTACCTCGAGACCGACAAGTTTCGATTGACATGT
TTCCAGACCTTGACGGGGACGAAGTTCTTGTTGTTCACGGATCCGTTGACGGGCGGCGTGGACGCAATCATTCAG
AGGATCTATGAGCTCTATGCCGACTATGTGATGAAGAATCCATTCTATCAGATTGAGATGCCGGTGCGATGCGAG
GCATTCGATCGGCATCTGGGCGCATGGTTGAGGGGGAGGACATAG
Gene >Pro_DTO377G3_2|g8736.t1
ATGCGACTTGGCCATTCAGTTAATAAAATCCTCTTTCATATGTACTGGAATTGAATAACCAAATATCTCTAAAAG
ATCTATAAAATAAATCGAAAGCGACGATTGGGTTGGCCGGTCCCCGCTTATCGACGCGGAATCAACAGTCTTCTC
CTCCTATCCCCGCGAACTCCATGCCAACACCTACTTTTGGTCCTCTGTACAACCTCAGTCATAGTCATACAGCTC
ACACAATTCGCCGGAATACCTCGAGAGATACCAATAGCGCCCTCCGCCCCTTGCTTCTCCGGCCGCGCTGTCCGT
ACCAGCGACTCAACTCACCATGTACGCTCCATCTGCTCAGTGAATCGCTCAGCAACTAACATGCCTTCTAACCCC
AGGGGCGTCTTCTCCCTGATCATTATCAACAAAGCCGGGGGCCTCATCTACCAGCGCGAGTTTCAATCTGGTTTG
CGCAACCTCTCGACAAATGACTACCTCGTCCTAGCTGGAACCTTTCACGGGTAAGTCAATACCATCTCTCTCCTG
GAATACATACCCATTGACTTGGATTCTATAGCGTTCACGCGATCACCCGCTCCATCACACCGAAAATTCCCATCG
CCCAACCTGCTCCCTCTACAACCTCAACGGGCACCGCCGCTCCTGCTGCGTCCGGTTACTCCTACCCAAACCCCG
GTGTACCAGTCTCCGGCTTGGATTACCTCGAGACCGACAAGTTTCGATTGACATGTTTCCAGACCTTGACGGGGA
CGAAGTTCTTGTTGTTCACGGATCCGTTGACGGGCGGCGTGGACGCAATCATTCAGAGGATCTATGAGCTCTATG
CCGACTATGTGATGAAGAATCCATTCTATCAGATTGAGATGCCGGTGCGATGCGAGGCATTCGATCGGCATCTGG
GCGCATGGTTGAGGGGGAGGACATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail