Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8710.t1
Gene name
Locationscaffold_36:92687..94748
Strand-
Gene length (bp)2061
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 1.7E-166 64 592

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 156 175 19
3 179 201 22
4 291 313 22
5 323 340 17
6 397 419 22
7 429 451 22
8 463 485 22
9 500 522 22
10 534 556 22
11 566 585 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 91.71 55.87 127.55
5d_25C Five days - 25 degrees Celsius 121.57 73.40 169.75
7d_25C Seven days - 25 degrees Celsius 110.56 65.96 155.16
10d_25C Ten days - 25 degrees Celsius 113.73 68.91 158.55
7d_15C Seven days - 15 degrees Celsius 162.21 92.89 231.53
7d_30C Seven days - 30 degrees Celsius 93.69 55.21 132.18

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.222094 no
3d_25C 7d_25C 0.461507 no
3d_25C 7d_15C 0.005626 yes
3d_25C 7d_30C 0.951535 no
3d_25C 10d_25C 0.365727 no
5d_25C 7d_25C 0.753683 no
5d_25C 7d_15C 0.227321 no
5d_25C 7d_30C 0.278288 no
5d_25C 10d_25C 0.832191 no
7d_25C 7d_15C 0.090191 no
7d_25C 7d_30C 0.535998 no
7d_25C 10d_25C 0.935970 no
7d_15C 7d_30C 0.010083 yes
7d_15C 10d_25C 0.107013 no
7d_30C 10d_25C 0.433703 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8710.t1
MLLVGALPPASARTWACKFVDSWGRIYTTFSMLSYISAAFRPPSPEEGVQQRPPRYAGEDTTPTSRREILGWYSY
GIAAEVFAVCGVGSFLPLTLEQLARERGTLQVSRLPCVGPSTGNSTNSAEHGQCVVPIFGAEVNTASFAIALADY
ENNRKILLMVFGFAGALASMLFIFIAPPIFIIGSILVVIGVTCLGSSFVVLNSYLPVLVANDPSLQEGKADDSAE
MSSFDRDGGNSEWNAWGSDDADNDSLDGLQPQEQPRSSLEGGLGAKAPPSSSPELQLSTKISSTGIGLGYCAAVF
VQIISIILLITLSKTSLVKVSGTLPMRFVLLLVGIWWGGFTLVTRNLLKTRPGPPLDSVATKGTARWRAWLRLIG
FAWKSLWETVKIVIKLREVLMFLVAWFLISDAMATVSATAILFARTELKLSTPLIGLLSITATVSGMTGAFLWPH
VSRYFGLRPNQTIILCIGMFEMIPLYGLLAYIPFIKKWGVFGLQQPWEIFPLAIVHGVVSGGLASYCRSFFGLMI
PPGSEAAFYALYAATDKGSSFIGPAIVGVLVDATGQIRSGFFFMALLILLPIPLVWMVNADKGRREGLAMAETLG
KSHGGPAEYAQEAEGLLARE*
Coding >Pro_DTO377G3_2|g8710.t1
ATGTTGCTCGTTGGGGCTCTTCCGCCCGCATCCGCGCGTACCTGGGCTTGTAAATTTGTGGATTCCTGGGGGAGA
ATTTACACAACCTTCTCCATGCTATCCTATATATCTGCTGCCTTTCGGCCCCCGTCGCCAGAGGAAGGCGTACAG
CAGCGACCACCACGGTATGCCGGTGAAGATACCACCCCAACGAGCCGCCGGGAGATCCTAGGATGGTACTCGTAC
GGGATTGCGGCGGAGGTGTTCGCGGTCTGTGGCGTAGGATCTTTCCTACCGCTCACCTTGGAACAATTAGCCCGC
GAGCGCGGCACCCTGCAAGTGAGCCGTCTTCCATGCGTCGGACCATCCACAGGGAACAGCACAAATAGTGCTGAG
CATGGCCAATGTGTGGTGCCGATCTTTGGCGCCGAGGTCAATACAGCTAGCTTCGCCATCGCGCTGGCGGATTAC
GAGAACAACCGCAAGATATTACTTATGGTATTCGGATTCGCCGGTGCGCTCGCCAGCATGTTGTTCATATTCATT
GCGCCGCCTATCTTCATTATCGGATCGATATTGGTCGTCATCGGTGTGACCTGCCTCGGTTCATCCTTTGTTGTG
CTGAACTCTTATCTCCCTGTGCTTGTCGCCAACGACCCATCTCTGCAAGAGGGAAAGGCGGATGACAGCGCGGAA
ATGTCGAGCTTCGATCGAGACGGAGGTAACTCGGAATGGAACGCCTGGGGCAGCGATGATGCCGACAACGATAGT
TTAGACGGACTTCAGCCACAAGAGCAGCCACGGAGCTCACTAGAAGGTGGACTAGGGGCCAAGGCCCCGCCGTCG
TCCTCCCCGGAGCTGCAGCTTTCCACCAAAATCTCCTCCACAGGCATTGGTCTTGGATATTGTGCGGCGGTTTTT
GTGCAAATCATCAGTATCATCCTGCTGATCACATTATCCAAGACCTCCCTTGTGAAAGTGTCTGGCACTCTTCCC
ATGCGCTTCGTATTGCTCCTGGTCGGCATCTGGTGGGGCGGGTTCACCTTGGTCACTCGTAATTTGCTCAAGACA
CGACCGGGGCCTCCCTTGGATTCAGTCGCCACCAAAGGCACAGCAAGATGGCGAGCCTGGCTACGACTGATCGGT
TTTGCCTGGAAATCACTATGGGAGACCGTGAAAATAGTCATCAAACTGCGCGAAGTCCTCATGTTCCTCGTAGCA
TGGTTCCTGATCTCCGATGCAATGGCCACTGTCTCTGCAACGGCGATCCTCTTCGCGCGGACGGAACTCAAACTG
AGCACACCGCTGATCGGACTTCTCTCCATCACTGCGACGGTGTCCGGCATGACGGGCGCATTCCTATGGCCACAT
GTATCTCGGTACTTCGGCCTACGGCCGAATCAAACCATCATCCTATGCATTGGCATGTTTGAGATGATACCACTC
TATGGGTTGCTTGCTTACATCCCCTTCATAAAAAAATGGGGTGTGTTCGGGCTACAACAGCCGTGGGAGATATTC
CCGCTGGCCATCGTCCACGGAGTCGTGTCGGGAGGACTGGCATCATACTGCCGATCGTTCTTCGGACTCATGATT
CCACCCGGTAGCGAGGCTGCGTTCTACGCTCTTTACGCTGCTACGGACAAGGGCAGCTCATTCATTGGGCCGGCT
ATTGTGGGCGTTCTTGTTGATGCGACCGGCCAAATCCGAAGTGGATTTTTCTTCATGGCGCTTCTGATCCTTCTG
CCTATCCCCCTTGTGTGGATGGTTAATGCGGACAAGGGTCGGCGTGAAGGTTTGGCTATGGCTGAAACCCTGGGC
AAGTCACATGGTGGGCCCGCCGAGTACGCCCAGGAAGCCGAAGGGCTTCTTGCTCGTGAGTAG
Transcript >Pro_DTO377G3_2|g8710.t1
ATGTTGCTCGTTGGGGCTCTTCCGCCCGCATCCGCGCGTACCTGGGCTTGTAAATTTGTGGATTCCTGGGGGAGA
ATTTACACAACCTTCTCCATGCTATCCTATATATCTGCTGCCTTTCGGCCCCCGTCGCCAGAGGAAGGCGTACAG
CAGCGACCACCACGGTATGCCGGTGAAGATACCACCCCAACGAGCCGCCGGGAGATCCTAGGATGGTACTCGTAC
GGGATTGCGGCGGAGGTGTTCGCGGTCTGTGGCGTAGGATCTTTCCTACCGCTCACCTTGGAACAATTAGCCCGC
GAGCGCGGCACCCTGCAAGTGAGCCGTCTTCCATGCGTCGGACCATCCACAGGGAACAGCACAAATAGTGCTGAG
CATGGCCAATGTGTGGTGCCGATCTTTGGCGCCGAGGTCAATACAGCTAGCTTCGCCATCGCGCTGGCGGATTAC
GAGAACAACCGCAAGATATTACTTATGGTATTCGGATTCGCCGGTGCGCTCGCCAGCATGTTGTTCATATTCATT
GCGCCGCCTATCTTCATTATCGGATCGATATTGGTCGTCATCGGTGTGACCTGCCTCGGTTCATCCTTTGTTGTG
CTGAACTCTTATCTCCCTGTGCTTGTCGCCAACGACCCATCTCTGCAAGAGGGAAAGGCGGATGACAGCGCGGAA
ATGTCGAGCTTCGATCGAGACGGAGGTAACTCGGAATGGAACGCCTGGGGCAGCGATGATGCCGACAACGATAGT
TTAGACGGACTTCAGCCACAAGAGCAGCCACGGAGCTCACTAGAAGGTGGACTAGGGGCCAAGGCCCCGCCGTCG
TCCTCCCCGGAGCTGCAGCTTTCCACCAAAATCTCCTCCACAGGCATTGGTCTTGGATATTGTGCGGCGGTTTTT
GTGCAAATCATCAGTATCATCCTGCTGATCACATTATCCAAGACCTCCCTTGTGAAAGTGTCTGGCACTCTTCCC
ATGCGCTTCGTATTGCTCCTGGTCGGCATCTGGTGGGGCGGGTTCACCTTGGTCACTCGTAATTTGCTCAAGACA
CGACCGGGGCCTCCCTTGGATTCAGTCGCCACCAAAGGCACAGCAAGATGGCGAGCCTGGCTACGACTGATCGGT
TTTGCCTGGAAATCACTATGGGAGACCGTGAAAATAGTCATCAAACTGCGCGAAGTCCTCATGTTCCTCGTAGCA
TGGTTCCTGATCTCCGATGCAATGGCCACTGTCTCTGCAACGGCGATCCTCTTCGCGCGGACGGAACTCAAACTG
AGCACACCGCTGATCGGACTTCTCTCCATCACTGCGACGGTGTCCGGCATGACGGGCGCATTCCTATGGCCACAT
GTATCTCGGTACTTCGGCCTACGGCCGAATCAAACCATCATCCTATGCATTGGCATGTTTGAGATGATACCACTC
TATGGGTTGCTTGCTTACATCCCCTTCATAAAAAAATGGGGTGTGTTCGGGCTACAACAGCCGTGGGAGATATTC
CCGCTGGCCATCGTCCACGGAGTCGTGTCGGGAGGACTGGCATCATACTGCCGATCGTTCTTCGGACTCATGATT
CCACCCGGTAGCGAGGCTGCGTTCTACGCTCTTTACGCTGCTACGGACAAGGGCAGCTCATTCATTGGGCCGGCT
ATTGTGGGCGTTCTTGTTGATGCGACCGGCCAAATCCGAAGTGGATTTTTCTTCATGGCGCTTCTGATCCTTCTG
CCTATCCCCCTTGTGTGGATGGTTAATGCGGACAAGGGTCGGCGTGAAGGTTTGGCTATGGCTGAAACCCTGGGC
AAGTCACATGGTGGGCCCGCCGAGTACGCCCAGGAAGCCGAAGGGCTTCTTGCTCGTGAGTAG
Gene >Pro_DTO377G3_2|g8710.t1
ATGTTGCTCGTTGGGGCTCTTCCGCCCGCATCCGCGCGTACCTGGGCTTGTAAATTTGTGGATTCCTGGGGGAGA
ATTTACACAACCTTCTCCATGCTATCCTATATATCTGCTGCCTTTCGGCCCCCGTCGCCAGAGGAAGGCGTACAG
CAGCGACCACCACGGTATGCCGGTGAAGATACCACCCCAACGAGCCGCCGGGAGATCCTAGGATGGTACTCGTAC
GGGATTGCGGCGGAGGTGTTCGCGGTCTGTGGCGTAGGTTCGTGAAGACATATCTGCAAACCTAAAATAATCAAT
TACTTATCGATCGCCACCAGGATCTTTCCTACCGCTCACCTTGGAACAATTAGCCCGCGAGCGCGGCACCCTGCA
AGTGAGCCGTCTTCCATGCGTCGGACCATCCACAGGGAACAGCACAAATAGTGCTGAGCATGGCCAATGTGTGGT
GCCGATCTTTGGCGCCGAGGTCAATACAGCTAGCTTCGCCATGTACACCTTCTCGCTAGCGGTACTCATACAGGC
GCTGACACTGATATCGTTCAGCGCGCTGGCGGATTACGGTATGGTTGCAGAACGCCGGACTGAGAATGTTTGGTG
CGAAAGAGGGACATGAGTTAACGTCAAATTTGTCCAATTGGATGTATAGAGAACAACCGCAAGATATTACTTATG
GTATTCGGATTCGCCGGTGCGCTCGCCAGCATGTTGTTCATATTCATTGCGCCGCCTATCTTCATTATCGGATCG
ATATTGGTCGTCATCGGTGTGACCTGCCTCGGTTCATCCTTTGTTGTGCTGAACTCTTATCTCCCTGTGCTTGTC
GCCAACGACCCATCTCTGCAAGAGGGAAAGGCGGATGACAGCGCGGAAATGTCGAGCTTCGATCGAGACGGAGGT
AACTCGGAATGGAACGCCTGGGGCAGCGATGATGCCGACAACGATAGTTTAGACGGACTTCAGCCACAAGAGCAG
CCACGGAGCTCACTAGAAGGTGGACTAGGGGCCAAGGCCCCGCCGTCGTCCTCCCCGGAGCTGCAGCTTTCCACC
AAAATCTCCTCCACAGGCATTGGTCTTGGATATTGTGCGGCGGTTTTTGTGCAAATCATCAGTATCATCCTGCTG
ATCACATTATCCAAGACCTCCCTTGTGAAAGTGTCTGGCACTCTTCCCATGCGCTTCGTATTGCTCCTGGTCGGC
ATCTGGTGGGGCGGGTTCACCTTGGTCACTCGTAATTTGCTCAAGACACGACCGGGGCCTCCCTTGGATTCAGTC
GCCACCAAAGGCACAGCAAGATGGCGAGCCTGGCTACGACTGATCGGTTTTGCCTGGAAATCACTATGGGAGACC
GTGAAAATAGTCATCAAACTGCGCGAAGTCCTCATGTTCCTCGTAGCATGGTTCCTGATCTCCGATGCAATGGCC
ACTGTCTCTGCAACGGCGATCCTCTTCGCGCGGACGGAACTCAAACTGAGCACACCGCTGATCGGACTTCTCTCC
ATCACTGCGACGGTGTCCGGCATGACGGGCGCATTCCTATGGCCACATGTATCTCGGTACTTCGGCCTACGGCCG
AATCAAACCATCATCCTATGCATTGGCATGTTTGAGATGATACCACTCTATGGGTTGCTTGCTTACATCCCCTTC
ATAAAAAAATGGGGTGTGTTCGGGCTACAACAGCCGTGGGAGATATTCCCGCTGGCCATCGTCCACGGAGTCGTG
TCGGGAGGACTGGCATCATACTGCCGATCGTTCTTCGGACTCATGATTCCACCCGGTAGCGAGGCTGCGTTCTAC
GCTCTTTACGCTGCTACGGACAAGGGCAGCTCATTCATTGGGCCGGCTATTGTGGGCGTTCTTGTTGATGCGACC
GGCCAAATCCGAAGTGGATTTTTCTTCATGGCGCTTCTGATCCTTCTGCCTATCCCCCTTGTGTGGATGGTTAAT
GCGGACAAGGGTCGGCGTGAAGGTTTGGCTATGGCTGAAACCCTGGGCAAGTCACATGGTGGGCCCGCCGAGTAC
GCCCAGGAAGCCGAAGGGCTTCTTGCTCGTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail