Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8710.t1
Gene name
Locationscaffold_36:92687..94748
Strand-
Gene length (bp)2061
Transcript length (bp)1863
Coding sequence length (bp)1863
Protein length (aa) 621

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 1.7E-166 64 592

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 71 93 22
2 156 175 19
3 179 201 22
4 291 313 22
5 323 340 17
6 397 419 22
7 429 451 22
8 463 485 22
9 500 522 22
10 534 556 22
11 566 585 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8710.t1
MLLVGALPPASARTWACKFVDSWGRIYTTFSMLSYISAAFRPPSPEEGVQQRPPRYAGEDTTPTSRREILGWYSY
GIAAEVFAVCGVGSFLPLTLEQLARERGTLQVSRLPCVGPSTGNSTNSAEHGQCVVPIFGAEVNTASFAIALADY
ENNRKILLMVFGFAGALASMLFIFIAPPIFIIGSILVVIGVTCLGSSFVVLNSYLPVLVANDPSLQEGKADDSAE
MSSFDRDGGNSEWNAWGSDDADNDSLDGLQPQEQPRSSLEGGLGAKAPPSSSPELQLSTKISSTGIGLGYCAAVF
VQIISIILLITLSKTSLVKVSGTLPMRFVLLLVGIWWGGFTLVTRNLLKTRPGPPLDSVATKGTARWRAWLRLIG
FAWKSLWETVKIVIKLREVLMFLVAWFLISDAMATVSATAILFARTELKLSTPLIGLLSITATVSGMTGAFLWPH
VSRYFGLRPNQTIILCIGMFEMIPLYGLLAYIPFIKKWGVFGLQQPWEIFPLAIVHGVVSGGLASYCRSFFGLMI
PPGSEAAFYALYAATDKGSSFIGPAIVGVLVDATGQIRSGFFFMALLILLPIPLVWMVNADKGRREGLAMAETLG
KSHGGPAEYAQEAEGLLARE*
Coding >Pro_DTO377G3_2|g8710.t1
ATGTTGCTCGTTGGGGCTCTTCCGCCCGCATCCGCGCGTACCTGGGCTTGTAAATTTGTGGATTCCTGGGGGAGA
ATTTACACAACCTTCTCCATGCTATCCTATATATCTGCTGCCTTTCGGCCCCCGTCGCCAGAGGAAGGCGTACAG
CAGCGACCACCACGGTATGCCGGTGAAGATACCACCCCAACGAGCCGCCGGGAGATCCTAGGATGGTACTCGTAC
GGGATTGCGGCGGAGGTGTTCGCGGTCTGTGGCGTAGGATCTTTCCTACCGCTCACCTTGGAACAATTAGCCCGC
GAGCGCGGCACCCTGCAAGTGAGCCGTCTTCCATGCGTCGGACCATCCACAGGGAACAGCACAAATAGTGCTGAG
CATGGCCAATGTGTGGTGCCGATCTTTGGCGCCGAGGTCAATACAGCTAGCTTCGCCATCGCGCTGGCGGATTAC
GAGAACAACCGCAAGATATTACTTATGGTATTCGGATTCGCCGGTGCGCTCGCCAGCATGTTGTTCATATTCATT
GCGCCGCCTATCTTCATTATCGGATCGATATTGGTCGTCATCGGTGTGACCTGCCTCGGTTCATCCTTTGTTGTG
CTGAACTCTTATCTCCCTGTGCTTGTCGCCAACGACCCATCTCTGCAAGAGGGAAAGGCGGATGACAGCGCGGAA
ATGTCGAGCTTCGATCGAGACGGAGGTAACTCGGAATGGAACGCCTGGGGCAGCGATGATGCCGACAACGATAGT
TTAGACGGACTTCAGCCACAAGAGCAGCCACGGAGCTCACTAGAAGGTGGACTAGGGGCCAAGGCCCCGCCGTCG
TCCTCCCCGGAGCTGCAGCTTTCCACCAAAATCTCCTCCACAGGCATTGGTCTTGGATATTGTGCGGCGGTTTTT
GTGCAAATCATCAGTATCATCCTGCTGATCACATTATCCAAGACCTCCCTTGTGAAAGTGTCTGGCACTCTTCCC
ATGCGCTTCGTATTGCTCCTGGTCGGCATCTGGTGGGGCGGGTTCACCTTGGTCACTCGTAATTTGCTCAAGACA
CGACCGGGGCCTCCCTTGGATTCAGTCGCCACCAAAGGCACAGCAAGATGGCGAGCCTGGCTACGACTGATCGGT
TTTGCCTGGAAATCACTATGGGAGACCGTGAAAATAGTCATCAAACTGCGCGAAGTCCTCATGTTCCTCGTAGCA
TGGTTCCTGATCTCCGATGCAATGGCCACTGTCTCTGCAACGGCGATCCTCTTCGCGCGGACGGAACTCAAACTG
AGCACACCGCTGATCGGACTTCTCTCCATCACTGCGACGGTGTCCGGCATGACGGGCGCATTCCTATGGCCACAT
GTATCTCGGTACTTCGGCCTACGGCCGAATCAAACCATCATCCTATGCATTGGCATGTTTGAGATGATACCACTC
TATGGGTTGCTTGCTTACATCCCCTTCATAAAAAAATGGGGTGTGTTCGGGCTACAACAGCCGTGGGAGATATTC
CCGCTGGCCATCGTCCACGGAGTCGTGTCGGGAGGACTGGCATCATACTGCCGATCGTTCTTCGGACTCATGATT
CCACCCGGTAGCGAGGCTGCGTTCTACGCTCTTTACGCTGCTACGGACAAGGGCAGCTCATTCATTGGGCCGGCT
ATTGTGGGCGTTCTTGTTGATGCGACCGGCCAAATCCGAAGTGGATTTTTCTTCATGGCGCTTCTGATCCTTCTG
CCTATCCCCCTTGTGTGGATGGTTAATGCGGACAAGGGTCGGCGTGAAGGTTTGGCTATGGCTGAAACCCTGGGC
AAGTCACATGGTGGGCCCGCCGAGTACGCCCAGGAAGCCGAAGGGCTTCTTGCTCGTGAGTAG
Transcript >Pro_DTO377G3_2|g8710.t1
ATGTTGCTCGTTGGGGCTCTTCCGCCCGCATCCGCGCGTACCTGGGCTTGTAAATTTGTGGATTCCTGGGGGAGA
ATTTACACAACCTTCTCCATGCTATCCTATATATCTGCTGCCTTTCGGCCCCCGTCGCCAGAGGAAGGCGTACAG
CAGCGACCACCACGGTATGCCGGTGAAGATACCACCCCAACGAGCCGCCGGGAGATCCTAGGATGGTACTCGTAC
GGGATTGCGGCGGAGGTGTTCGCGGTCTGTGGCGTAGGATCTTTCCTACCGCTCACCTTGGAACAATTAGCCCGC
GAGCGCGGCACCCTGCAAGTGAGCCGTCTTCCATGCGTCGGACCATCCACAGGGAACAGCACAAATAGTGCTGAG
CATGGCCAATGTGTGGTGCCGATCTTTGGCGCCGAGGTCAATACAGCTAGCTTCGCCATCGCGCTGGCGGATTAC
GAGAACAACCGCAAGATATTACTTATGGTATTCGGATTCGCCGGTGCGCTCGCCAGCATGTTGTTCATATTCATT
GCGCCGCCTATCTTCATTATCGGATCGATATTGGTCGTCATCGGTGTGACCTGCCTCGGTTCATCCTTTGTTGTG
CTGAACTCTTATCTCCCTGTGCTTGTCGCCAACGACCCATCTCTGCAAGAGGGAAAGGCGGATGACAGCGCGGAA
ATGTCGAGCTTCGATCGAGACGGAGGTAACTCGGAATGGAACGCCTGGGGCAGCGATGATGCCGACAACGATAGT
TTAGACGGACTTCAGCCACAAGAGCAGCCACGGAGCTCACTAGAAGGTGGACTAGGGGCCAAGGCCCCGCCGTCG
TCCTCCCCGGAGCTGCAGCTTTCCACCAAAATCTCCTCCACAGGCATTGGTCTTGGATATTGTGCGGCGGTTTTT
GTGCAAATCATCAGTATCATCCTGCTGATCACATTATCCAAGACCTCCCTTGTGAAAGTGTCTGGCACTCTTCCC
ATGCGCTTCGTATTGCTCCTGGTCGGCATCTGGTGGGGCGGGTTCACCTTGGTCACTCGTAATTTGCTCAAGACA
CGACCGGGGCCTCCCTTGGATTCAGTCGCCACCAAAGGCACAGCAAGATGGCGAGCCTGGCTACGACTGATCGGT
TTTGCCTGGAAATCACTATGGGAGACCGTGAAAATAGTCATCAAACTGCGCGAAGTCCTCATGTTCCTCGTAGCA
TGGTTCCTGATCTCCGATGCAATGGCCACTGTCTCTGCAACGGCGATCCTCTTCGCGCGGACGGAACTCAAACTG
AGCACACCGCTGATCGGACTTCTCTCCATCACTGCGACGGTGTCCGGCATGACGGGCGCATTCCTATGGCCACAT
GTATCTCGGTACTTCGGCCTACGGCCGAATCAAACCATCATCCTATGCATTGGCATGTTTGAGATGATACCACTC
TATGGGTTGCTTGCTTACATCCCCTTCATAAAAAAATGGGGTGTGTTCGGGCTACAACAGCCGTGGGAGATATTC
CCGCTGGCCATCGTCCACGGAGTCGTGTCGGGAGGACTGGCATCATACTGCCGATCGTTCTTCGGACTCATGATT
CCACCCGGTAGCGAGGCTGCGTTCTACGCTCTTTACGCTGCTACGGACAAGGGCAGCTCATTCATTGGGCCGGCT
ATTGTGGGCGTTCTTGTTGATGCGACCGGCCAAATCCGAAGTGGATTTTTCTTCATGGCGCTTCTGATCCTTCTG
CCTATCCCCCTTGTGTGGATGGTTAATGCGGACAAGGGTCGGCGTGAAGGTTTGGCTATGGCTGAAACCCTGGGC
AAGTCACATGGTGGGCCCGCCGAGTACGCCCAGGAAGCCGAAGGGCTTCTTGCTCGTGAGTAG
Gene >Pro_DTO377G3_2|g8710.t1
ATGTTGCTCGTTGGGGCTCTTCCGCCCGCATCCGCGCGTACCTGGGCTTGTAAATTTGTGGATTCCTGGGGGAGA
ATTTACACAACCTTCTCCATGCTATCCTATATATCTGCTGCCTTTCGGCCCCCGTCGCCAGAGGAAGGCGTACAG
CAGCGACCACCACGGTATGCCGGTGAAGATACCACCCCAACGAGCCGCCGGGAGATCCTAGGATGGTACTCGTAC
GGGATTGCGGCGGAGGTGTTCGCGGTCTGTGGCGTAGGTTCGTGAAGACATATCTGCAAACCTAAAATAATCAAT
TACTTATCGATCGCCACCAGGATCTTTCCTACCGCTCACCTTGGAACAATTAGCCCGCGAGCGCGGCACCCTGCA
AGTGAGCCGTCTTCCATGCGTCGGACCATCCACAGGGAACAGCACAAATAGTGCTGAGCATGGCCAATGTGTGGT
GCCGATCTTTGGCGCCGAGGTCAATACAGCTAGCTTCGCCATGTACACCTTCTCGCTAGCGGTACTCATACAGGC
GCTGACACTGATATCGTTCAGCGCGCTGGCGGATTACGGTATGGTTGCAGAACGCCGGACTGAGAATGTTTGGTG
CGAAAGAGGGACATGAGTTAACGTCAAATTTGTCCAATTGGATGTATAGAGAACAACCGCAAGATATTACTTATG
GTATTCGGATTCGCCGGTGCGCTCGCCAGCATGTTGTTCATATTCATTGCGCCGCCTATCTTCATTATCGGATCG
ATATTGGTCGTCATCGGTGTGACCTGCCTCGGTTCATCCTTTGTTGTGCTGAACTCTTATCTCCCTGTGCTTGTC
GCCAACGACCCATCTCTGCAAGAGGGAAAGGCGGATGACAGCGCGGAAATGTCGAGCTTCGATCGAGACGGAGGT
AACTCGGAATGGAACGCCTGGGGCAGCGATGATGCCGACAACGATAGTTTAGACGGACTTCAGCCACAAGAGCAG
CCACGGAGCTCACTAGAAGGTGGACTAGGGGCCAAGGCCCCGCCGTCGTCCTCCCCGGAGCTGCAGCTTTCCACC
AAAATCTCCTCCACAGGCATTGGTCTTGGATATTGTGCGGCGGTTTTTGTGCAAATCATCAGTATCATCCTGCTG
ATCACATTATCCAAGACCTCCCTTGTGAAAGTGTCTGGCACTCTTCCCATGCGCTTCGTATTGCTCCTGGTCGGC
ATCTGGTGGGGCGGGTTCACCTTGGTCACTCGTAATTTGCTCAAGACACGACCGGGGCCTCCCTTGGATTCAGTC
GCCACCAAAGGCACAGCAAGATGGCGAGCCTGGCTACGACTGATCGGTTTTGCCTGGAAATCACTATGGGAGACC
GTGAAAATAGTCATCAAACTGCGCGAAGTCCTCATGTTCCTCGTAGCATGGTTCCTGATCTCCGATGCAATGGCC
ACTGTCTCTGCAACGGCGATCCTCTTCGCGCGGACGGAACTCAAACTGAGCACACCGCTGATCGGACTTCTCTCC
ATCACTGCGACGGTGTCCGGCATGACGGGCGCATTCCTATGGCCACATGTATCTCGGTACTTCGGCCTACGGCCG
AATCAAACCATCATCCTATGCATTGGCATGTTTGAGATGATACCACTCTATGGGTTGCTTGCTTACATCCCCTTC
ATAAAAAAATGGGGTGTGTTCGGGCTACAACAGCCGTGGGAGATATTCCCGCTGGCCATCGTCCACGGAGTCGTG
TCGGGAGGACTGGCATCATACTGCCGATCGTTCTTCGGACTCATGATTCCACCCGGTAGCGAGGCTGCGTTCTAC
GCTCTTTACGCTGCTACGGACAAGGGCAGCTCATTCATTGGGCCGGCTATTGTGGGCGTTCTTGTTGATGCGACC
GGCCAAATCCGAAGTGGATTTTTCTTCATGGCGCTTCTGATCCTTCTGCCTATCCCCCTTGTGTGGATGGTTAAT
GCGGACAAGGGTCGGCGTGAAGGTTTGGCTATGGCTGAAACCCTGGGCAAGTCACATGGTGGGCCCGCCGAGTAC
GCCCAGGAAGCCGAAGGGCTTCTTGCTCGTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail