Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g871.t1
Gene name
Locationscaffold_01:2322238..2328288
Strand-
Gene length (bp)6050
Transcript length (bp)5727
Coding sequence length (bp)5727
Protein length (aa) 1909

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 3.2E-37 331 870
PF00501 AMP-binding AMP-binding enzyme 1.0E-26 1084 1535
PF06464 DMAP_binding DMAP1-binding Domain 1.0E-08 7 44

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 44.47 26.88 62.07
5d_25C Five days - 25 degrees Celsius 44.45 26.81 62.08
7d_25C Seven days - 25 degrees Celsius 41.30 24.96 57.63
10d_25C Ten days - 25 degrees Celsius 41.56 25.02 58.10
7d_15C Seven days - 15 degrees Celsius 50.83 30.09 71.57
7d_30C Seven days - 30 degrees Celsius 35.40 21.48 49.32

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.998162 no
3d_25C 7d_25C 0.812531 no
3d_25C 7d_15C 0.634124 no
3d_25C 7d_30C 0.336719 no
3d_25C 10d_25C 0.827355 no
5d_25C 7d_25C 0.812644 no
5d_25C 7d_15C 0.632917 no
5d_25C 7d_30C 0.344451 no
5d_25C 10d_25C 0.828297 no
7d_25C 7d_15C 0.408102 no
7d_25C 7d_30C 0.556681 no
7d_25C 10d_25C 0.985959 no
7d_15C 7d_30C 0.089334 no
7d_15C 10d_25C 0.425021 no
7d_30C 10d_25C 0.537195 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g871.t1
MAEESPEIQAALRDLDRELEEGDITQKGYQKRRTILLSQYFGPNKPLDINSQAGLGYDASPTSPGRVPPAILSVR
PPTADSSLPHVTSPIYAGSHGSQGSGAVGYDQGAGINTQDQSHASLGSHRRESMLQAHDRAPSGSSYDSLFLPKP
PAPGLQGQDGSRTATLMSQNYAFNPNSQPEYMSQPEYAQEYPQEYPQEYAQEYPQEYTPAEPEYADEGMAYYDPA
SGAPTRQSTMLDSQQGYFSDFAGQQHDDYRDSYGGGFHRYSQSGEAFSPTANMAPPLMPAGAELQHGPAIEHLLP
LEPREIPFSLNDPHDKNVPMSNFDNLPAVLRHRARAHPKQAAYWVLDAKGKEVASITWEKLSSRAEKVAQVIRDK
SNLYRGDRVALIYREAEIIEFAVALLGCFIAGVVAVPINSLDDYTSLNIVLTSTQAHLALTTENNLKNFQRDITA
QKLSWPRGVEWWKTNEFGSFHPKKKDDTPALQVPDLAYIEFARAPTGDMRGVVMSHRTIMHQMACLSAIISTVPV
ESSARQYSTKGETIISYLDPRQGIGMIMAILFTVYGGHTTVWHEDRAVETPGLYAHLITKYKASVMATDYSGLKI
ATYNYQQDPMATRHFKKNSEPNFSSVKLCLIDTLTLDPEFHEILADRWLRPMRNPRAREIVAPMLCLPEHGGMVI
SMRDWLGGEERMGCSLTHEMDPAGRDDYKKEDESLTKSETKTGFGSSLLGGGSRVSTIKQSPKNELSEVLLDKEA
LKSNEVVVLAMGEDARKYASSMPHAVRVGAFGYPIPDATLAVVDPETNLLCTPNVIGEIWVDSPSLSGGFWALPK
HTEAIFHARPYKFEEPNPTPILVEPEFLRTGLLGCVIEGRLFVLGLYEDRLRQKVEWVEHGQEIVEHRYFFVQHL
TVSILKKVPKIHDCTAFDVFVNEEHLPVIILESYSASTAPTTSGGPPRQLDSVLLDSLADRCMEVLYQEHHLRVY
CVLLTAPNSLPRVTKNGRQEIGNMLCRKDFECGMLQAVHVKFGVERSVMNLPVGVDPEGGIWSPTALASRQDLLA
YQEKQYSGVDYRDVVMDDRTSTPLNNFNTIVDLLQWRVARQAEELAYCSIDSRGKEGKGVTWKKFDLKVSAVATY
LKNKVKVRPGDHLVLMYTHSEEYVYAVHACLCLGAVVIPMAPIDQNRLSEDAPAFLHVIGDFNIKAIIVNNDVDH
VMRQKLVSQHIKQSAQVLRIGVPAIYNTTKPSKQSHGCRELGYTVKDTWLQGNQPAMVWTYWTPDQRRISVQISH
ETIMGMCKVQKETCQMTSSRPVLGSVRSTLGLGFLHTCLMGIYVGAPTYLVSPVDFAQNPLTLFVTLARYKIKDT
YATSQMLDYAMSAMAGKGFQLQELKNLMISAEGRPRTDLYGKVRLHFANASLDRTSINVIYSHVLNPMVTTRSYM
CIEPIELWLDLRSLRQGLIYPVDPDADPTALLLQDSGMVPVNTQIAIVNPETCTLSHVGEYGEIWVQSDACAEGF
YKSKQEFDSERLNGRVADGDPSVPYVRTGDLGFLHTVTRPIGPGGQPVDMQVLFLLGSIGETFEVNGLNHFPMDI
ENSVESCHRNIVNGGCAIFQAGGLVVVVVEVTRKAYLAALVPVIVDVILMEHQVVADIVAFVSHGDFPRSRLGEK
QRGKVLASWVTRKLRTIAQFSIRDLEGDSPFADIPQHRMSRVSKAGSTMGTSIRQSTMNPDIDANVPRSLRGVTL
EETSHPAATYQTGQAGSVPYELGSVTDNSPLATPIPGPSSAVPHIKEPQSATVVAEFDDQHYNTLDPTAGTSAVD
RDFRFSFDMADNPDQSQSYGHPGDERPSTGREPLPSQQGWNPNSPQAASTPPAETARPSTQDSGVNDWPQEALMY
QSALGAEDGHDVGRTDSDNSAPPNRQLRGLNLD*
Coding >Pro_DTO377G3_2|g871.t1
ATGGCGGAAGAGTCTCCCGAGATACAGGCCGCTTTGCGGGACCTAGATCGGGAATTGGAGGAGGGCGATATCACT
CAAAAAGGATACCAGAAGCGACGTACGATCCTGCTTTCGCAATATTTCGGTCCCAACAAGCCCCTTGATATCAAT
TCACAGGCCGGTCTTGGCTACGATGCATCCCCAACCAGCCCTGGAAGGGTCCCGCCGGCCATTCTGAGCGTTCGC
CCACCAACTGCCGATTCTTCCCTGCCACACGTCACTTCCCCCATTTACGCAGGCAGTCATGGCTCACAGGGCAGC
GGAGCCGTCGGATATGATCAAGGTGCCGGTATAAATACACAGGATCAGTCGCATGCATCGCTAGGGTCTCATCGT
AGAGAAAGCATGCTCCAAGCTCATGACCGCGCGCCTTCAGGGAGCTCTTACGACTCCCTCTTCCTTCCTAAACCC
CCAGCCCCAGGGTTACAAGGCCAGGATGGTTCCAGAACCGCAACTTTAATGAGTCAGAACTACGCGTTCAATCCA
AATTCTCAGCCCGAATATATGTCTCAGCCCGAGTACGCTCAGGAGTACCCTCAGGAGTACCCTCAGGAGTACGCT
CAGGAATATCCTCAGGAGTATACCCCCGCCGAACCTGAGTACGCGGACGAGGGCATGGCATATTACGATCCAGCA
TCTGGAGCGCCCACGCGACAGTCCACGATGCTTGATTCCCAGCAGGGCTACTTTTCCGACTTTGCGGGGCAACAG
CATGATGATTATAGGGATAGCTATGGAGGTGGCTTCCACCGCTATTCTCAGTCCGGGGAAGCCTTTTCGCCAACA
GCAAACATGGCCCCGCCATTGATGCCTGCTGGGGCGGAACTTCAGCACGGACCGGCTATTGAGCATCTACTTCCC
CTCGAACCTCGAGAGATTCCTTTCTCATTGAACGATCCGCACGACAAAAATGTCCCCATGTCGAACTTTGACAAC
CTGCCCGCGGTGTTACGGCATCGTGCTCGGGCTCACCCCAAGCAAGCAGCATATTGGGTGCTGGATGCAAAGGGC
AAGGAGGTTGCATCGATAACGTGGGAAAAACTGTCTAGTCGCGCCGAGAAAGTTGCTCAGGTTATTCGCGATAAG
AGTAATCTATATCGCGGAGATCGTGTCGCTCTCATCTACCGCGAAGCTGAAATTATCGAGTTCGCTGTCGCGCTC
TTGGGCTGCTTTATTGCAGGAGTTGTCGCCGTGCCTATCAACAGTCTGGATGATTACACAAGTCTAAATATTGTG
CTCACCTCAACGCAGGCACATCTGGCATTGACAACTGAGAATAACCTGAAGAACTTCCAACGCGATATCACAGCT
CAAAAACTCAGTTGGCCACGAGGAGTCGAGTGGTGGAAGACGAATGAGTTCGGCAGTTTCCATCCAAAGAAGAAG
GACGATACACCTGCGCTGCAGGTCCCCGATCTGGCCTATATTGAGTTTGCGAGGGCCCCGACGGGTGATATGCGT
GGTGTTGTGATGAGCCACCGGACTATCATGCATCAAATGGCATGTCTGAGTGCGATCATTTCTACAGTTCCTGTG
GAGTCAAGCGCTAGGCAATATAGCACTAAGGGAGAGACGATCATCAGTTACCTCGATCCGAGACAAGGAATTGGT
ATGATCATGGCCATTCTCTTCACCGTTTACGGTGGCCATACAACCGTTTGGCACGAGGACCGGGCTGTGGAAACA
CCCGGTTTATATGCCCATCTCATCACCAAATACAAGGCATCAGTCATGGCGACCGATTACTCTGGCTTGAAGATC
GCCACCTACAACTACCAGCAAGATCCGATGGCCACAAGACATTTTAAGAAAAACTCGGAACCTAATTTCAGCAGC
GTCAAACTCTGTCTCATCGATACGCTTACTCTCGACCCTGAGTTCCATGAAATCCTGGCAGACAGATGGCTTCGG
CCAATGAGGAACCCACGGGCTAGAGAAATTGTGGCTCCGATGCTCTGCTTACCAGAGCATGGAGGTATGGTCATT
AGTATGCGTGACTGGCTCGGTGGTGAAGAGCGAATGGGATGTTCCTTGACCCATGAAATGGACCCAGCCGGCCGC
GATGATTATAAGAAAGAGGACGAGAGCCTTACCAAGTCTGAGACTAAAACGGGCTTCGGAAGCAGTCTTCTGGGT
GGTGGATCACGAGTTTCTACGATCAAGCAGAGCCCTAAAAACGAGCTTAGCGAGGTGCTTCTAGACAAAGAGGCA
TTAAAGAGCAATGAAGTGGTTGTGCTAGCCATGGGCGAGGATGCACGAAAGTATGCCAGCAGTATGCCGCATGCT
GTACGCGTTGGCGCTTTCGGCTACCCAATTCCTGACGCAACTCTCGCTGTCGTTGATCCGGAGACCAATCTCCTT
TGTACGCCAAATGTTATTGGAGAGATTTGGGTTGATTCACCCTCTCTTTCTGGTGGCTTCTGGGCATTGCCGAAA
CACACAGAGGCCATATTCCACGCTCGCCCCTACAAATTCGAGGAGCCTAACCCGACCCCGATACTCGTGGAACCT
GAATTCCTGCGCACTGGTCTACTTGGATGTGTGATTGAGGGCCGACTTTTCGTGCTTGGTCTCTACGAGGATCGT
CTCCGCCAAAAAGTCGAATGGGTTGAGCACGGCCAAGAGATTGTGGAACATCGATACTTCTTCGTTCAACATCTA
ACAGTTAGCATTCTTAAGAAGGTGCCGAAAATTCATGATTGTACTGCGTTCGATGTGTTTGTTAACGAAGAACAT
CTTCCTGTGATTATTTTGGAGTCTTACTCGGCCTCAACGGCGCCAACAACTTCCGGCGGTCCGCCAAGGCAGCTC
GACTCGGTTCTTCTTGATTCGCTCGCCGACAGGTGTATGGAGGTACTATACCAAGAGCATCATCTACGGGTATAC
TGTGTTCTACTTACAGCCCCGAACAGTCTGCCGCGCGTTACCAAGAATGGCAGACAAGAAATTGGCAACATGCTC
TGTCGCAAAGATTTCGAGTGCGGTATGCTGCAAGCAGTGCATGTTAAGTTTGGAGTTGAACGATCAGTGATGAAC
CTGCCCGTCGGTGTTGATCCTGAGGGTGGAATCTGGTCCCCCACTGCTCTAGCATCACGACAAGACTTGCTTGCC
TACCAGGAAAAGCAATATTCGGGTGTGGATTATCGCGATGTAGTGATGGATGACCGAACTTCCACCCCATTGAAC
AACTTTAACACAATCGTCGACCTTCTTCAATGGCGAGTCGCTCGCCAAGCTGAAGAATTGGCTTACTGCTCTATC
GATAGCCGTGGAAAGGAAGGAAAAGGCGTCACCTGGAAGAAGTTTGACCTCAAAGTTTCTGCGGTGGCGACCTAC
CTCAAGAACAAGGTGAAGGTGCGACCAGGAGATCATCTCGTGCTGATGTACACCCACTCGGAAGAGTACGTCTAT
GCCGTCCATGCTTGTCTGTGCTTGGGTGCCGTTGTCATCCCGATGGCTCCTATTGATCAAAACCGTCTTTCGGAG
GATGCTCCTGCATTCTTGCACGTCATCGGCGACTTCAACATCAAGGCCATCATTGTCAATAACGATGTTGACCAT
GTCATGAGGCAGAAGCTTGTGTCGCAGCATATCAAGCAGTCCGCCCAGGTTCTTCGCATTGGTGTTCCTGCTATA
TACAATACCACAAAGCCCTCGAAGCAGTCCCACGGATGTCGCGAGCTCGGCTACACTGTGAAGGATACTTGGCTC
CAGGGTAACCAGCCTGCTATGGTCTGGACTTATTGGACCCCAGATCAGCGAAGAATCTCGGTGCAAATTTCCCAT
GAAACCATAATGGGCATGTGCAAGGTTCAAAAAGAAACCTGCCAAATGACAAGCTCAAGGCCGGTGCTTGGAAGT
GTTCGAAGTACCCTGGGTCTCGGATTCCTCCACACCTGCTTGATGGGCATTTACGTCGGTGCGCCTACATATCTA
GTTTCACCAGTCGATTTCGCTCAAAACCCATTGACTCTCTTCGTAACCCTTGCTCGGTACAAGATCAAGGACACT
TACGCCACCAGTCAGATGTTGGATTACGCAATGAGTGCTATGGCTGGAAAAGGCTTCCAGCTTCAAGAACTGAAG
AACCTGATGATTTCCGCAGAGGGGCGGCCTAGAACGGATCTCTATGGAAAGGTACGCCTACATTTCGCCAATGCC
AGCTTGGACCGTACCTCGATCAACGTCATTTACTCGCACGTTCTCAACCCGATGGTTACCACACGATCATACATG
TGCATTGAGCCGATCGAACTATGGCTCGACTTGCGAAGCCTCCGTCAAGGTCTTATTTACCCCGTAGACCCCGAT
GCCGATCCTACCGCGCTTTTGCTGCAGGATTCGGGCATGGTCCCAGTTAACACACAGATTGCGATCGTGAACCCG
GAGACCTGCACTCTCTCGCACGTTGGAGAGTACGGTGAGATCTGGGTCCAGTCCGACGCTTGCGCTGAGGGGTTC
TACAAATCAAAGCAAGAATTTGACTCCGAGCGGTTGAACGGCAGAGTTGCAGACGGTGACCCCAGCGTGCCTTAT
GTCCGTACTGGTGATCTTGGTTTCCTTCACACCGTTACTCGGCCGATCGGTCCTGGCGGCCAGCCAGTTGATATG
CAAGTCCTCTTCCTCCTCGGCAGTATCGGCGAAACTTTTGAAGTCAATGGACTCAATCACTTCCCTATGGACATT
GAAAACTCCGTAGAGAGTTGCCACCGCAATATCGTGAATGGAGGATGTGCTATTTTCCAAGCCGGTGGCTTGGTC
GTTGTTGTCGTTGAAGTTACCCGAAAAGCCTATCTAGCGGCCCTGGTCCCCGTCATTGTTGATGTTATCCTCATG
GAGCACCAAGTCGTTGCGGATATTGTCGCATTCGTCTCCCACGGCGACTTCCCCCGCTCTCGTCTAGGCGAGAAG
CAGCGCGGCAAGGTTCTCGCCTCATGGGTAACCCGGAAGCTGCGAACCATTGCTCAGTTCAGTATTCGCGACCTG
GAGGGCGATAGCCCATTTGCGGACATACCTCAGCACCGGATGAGCAGAGTTTCCAAGGCTGGAAGCACCATGGGC
ACCAGCATCCGACAGTCCACAATGAATCCGGATATCGACGCAAATGTCCCTCGCTCTCTACGTGGGGTGACATTG
GAAGAGACCAGTCATCCCGCGGCTACTTATCAGACCGGCCAAGCCGGGTCTGTGCCGTATGAACTGGGGAGTGTT
ACTGACAATAGTCCTCTTGCCACTCCTATCCCCGGGCCTAGCTCTGCTGTGCCTCACATCAAGGAGCCACAGTCT
GCCACGGTCGTAGCCGAGTTTGATGATCAACACTACAACACGTTGGATCCCACCGCGGGTACGTCCGCCGTGGAC
CGTGATTTCCGGTTCAGTTTTGATATGGCCGACAACCCTGACCAGTCTCAATCGTATGGACACCCTGGCGATGAA
CGGCCCTCGACGGGACGAGAGCCGCTTCCTAGCCAACAGGGATGGAACCCCAACAGCCCCCAGGCTGCTAGCACA
CCCCCTGCTGAGACGGCACGTCCAAGCACACAGGACAGTGGGGTCAATGATTGGCCCCAAGAAGCTCTCATGTAC
CAGTCGGCACTAGGCGCAGAAGACGGGCATGACGTTGGCCGCACAGACAGCGACAATTCTGCACCGCCAAATCGG
CAACTACGAGGCTTGAACTTGGATTGA
Transcript >Pro_DTO377G3_2|g871.t1
ATGGCGGAAGAGTCTCCCGAGATACAGGCCGCTTTGCGGGACCTAGATCGGGAATTGGAGGAGGGCGATATCACT
CAAAAAGGATACCAGAAGCGACGTACGATCCTGCTTTCGCAATATTTCGGTCCCAACAAGCCCCTTGATATCAAT
TCACAGGCCGGTCTTGGCTACGATGCATCCCCAACCAGCCCTGGAAGGGTCCCGCCGGCCATTCTGAGCGTTCGC
CCACCAACTGCCGATTCTTCCCTGCCACACGTCACTTCCCCCATTTACGCAGGCAGTCATGGCTCACAGGGCAGC
GGAGCCGTCGGATATGATCAAGGTGCCGGTATAAATACACAGGATCAGTCGCATGCATCGCTAGGGTCTCATCGT
AGAGAAAGCATGCTCCAAGCTCATGACCGCGCGCCTTCAGGGAGCTCTTACGACTCCCTCTTCCTTCCTAAACCC
CCAGCCCCAGGGTTACAAGGCCAGGATGGTTCCAGAACCGCAACTTTAATGAGTCAGAACTACGCGTTCAATCCA
AATTCTCAGCCCGAATATATGTCTCAGCCCGAGTACGCTCAGGAGTACCCTCAGGAGTACCCTCAGGAGTACGCT
CAGGAATATCCTCAGGAGTATACCCCCGCCGAACCTGAGTACGCGGACGAGGGCATGGCATATTACGATCCAGCA
TCTGGAGCGCCCACGCGACAGTCCACGATGCTTGATTCCCAGCAGGGCTACTTTTCCGACTTTGCGGGGCAACAG
CATGATGATTATAGGGATAGCTATGGAGGTGGCTTCCACCGCTATTCTCAGTCCGGGGAAGCCTTTTCGCCAACA
GCAAACATGGCCCCGCCATTGATGCCTGCTGGGGCGGAACTTCAGCACGGACCGGCTATTGAGCATCTACTTCCC
CTCGAACCTCGAGAGATTCCTTTCTCATTGAACGATCCGCACGACAAAAATGTCCCCATGTCGAACTTTGACAAC
CTGCCCGCGGTGTTACGGCATCGTGCTCGGGCTCACCCCAAGCAAGCAGCATATTGGGTGCTGGATGCAAAGGGC
AAGGAGGTTGCATCGATAACGTGGGAAAAACTGTCTAGTCGCGCCGAGAAAGTTGCTCAGGTTATTCGCGATAAG
AGTAATCTATATCGCGGAGATCGTGTCGCTCTCATCTACCGCGAAGCTGAAATTATCGAGTTCGCTGTCGCGCTC
TTGGGCTGCTTTATTGCAGGAGTTGTCGCCGTGCCTATCAACAGTCTGGATGATTACACAAGTCTAAATATTGTG
CTCACCTCAACGCAGGCACATCTGGCATTGACAACTGAGAATAACCTGAAGAACTTCCAACGCGATATCACAGCT
CAAAAACTCAGTTGGCCACGAGGAGTCGAGTGGTGGAAGACGAATGAGTTCGGCAGTTTCCATCCAAAGAAGAAG
GACGATACACCTGCGCTGCAGGTCCCCGATCTGGCCTATATTGAGTTTGCGAGGGCCCCGACGGGTGATATGCGT
GGTGTTGTGATGAGCCACCGGACTATCATGCATCAAATGGCATGTCTGAGTGCGATCATTTCTACAGTTCCTGTG
GAGTCAAGCGCTAGGCAATATAGCACTAAGGGAGAGACGATCATCAGTTACCTCGATCCGAGACAAGGAATTGGT
ATGATCATGGCCATTCTCTTCACCGTTTACGGTGGCCATACAACCGTTTGGCACGAGGACCGGGCTGTGGAAACA
CCCGGTTTATATGCCCATCTCATCACCAAATACAAGGCATCAGTCATGGCGACCGATTACTCTGGCTTGAAGATC
GCCACCTACAACTACCAGCAAGATCCGATGGCCACAAGACATTTTAAGAAAAACTCGGAACCTAATTTCAGCAGC
GTCAAACTCTGTCTCATCGATACGCTTACTCTCGACCCTGAGTTCCATGAAATCCTGGCAGACAGATGGCTTCGG
CCAATGAGGAACCCACGGGCTAGAGAAATTGTGGCTCCGATGCTCTGCTTACCAGAGCATGGAGGTATGGTCATT
AGTATGCGTGACTGGCTCGGTGGTGAAGAGCGAATGGGATGTTCCTTGACCCATGAAATGGACCCAGCCGGCCGC
GATGATTATAAGAAAGAGGACGAGAGCCTTACCAAGTCTGAGACTAAAACGGGCTTCGGAAGCAGTCTTCTGGGT
GGTGGATCACGAGTTTCTACGATCAAGCAGAGCCCTAAAAACGAGCTTAGCGAGGTGCTTCTAGACAAAGAGGCA
TTAAAGAGCAATGAAGTGGTTGTGCTAGCCATGGGCGAGGATGCACGAAAGTATGCCAGCAGTATGCCGCATGCT
GTACGCGTTGGCGCTTTCGGCTACCCAATTCCTGACGCAACTCTCGCTGTCGTTGATCCGGAGACCAATCTCCTT
TGTACGCCAAATGTTATTGGAGAGATTTGGGTTGATTCACCCTCTCTTTCTGGTGGCTTCTGGGCATTGCCGAAA
CACACAGAGGCCATATTCCACGCTCGCCCCTACAAATTCGAGGAGCCTAACCCGACCCCGATACTCGTGGAACCT
GAATTCCTGCGCACTGGTCTACTTGGATGTGTGATTGAGGGCCGACTTTTCGTGCTTGGTCTCTACGAGGATCGT
CTCCGCCAAAAAGTCGAATGGGTTGAGCACGGCCAAGAGATTGTGGAACATCGATACTTCTTCGTTCAACATCTA
ACAGTTAGCATTCTTAAGAAGGTGCCGAAAATTCATGATTGTACTGCGTTCGATGTGTTTGTTAACGAAGAACAT
CTTCCTGTGATTATTTTGGAGTCTTACTCGGCCTCAACGGCGCCAACAACTTCCGGCGGTCCGCCAAGGCAGCTC
GACTCGGTTCTTCTTGATTCGCTCGCCGACAGGTGTATGGAGGTACTATACCAAGAGCATCATCTACGGGTATAC
TGTGTTCTACTTACAGCCCCGAACAGTCTGCCGCGCGTTACCAAGAATGGCAGACAAGAAATTGGCAACATGCTC
TGTCGCAAAGATTTCGAGTGCGGTATGCTGCAAGCAGTGCATGTTAAGTTTGGAGTTGAACGATCAGTGATGAAC
CTGCCCGTCGGTGTTGATCCTGAGGGTGGAATCTGGTCCCCCACTGCTCTAGCATCACGACAAGACTTGCTTGCC
TACCAGGAAAAGCAATATTCGGGTGTGGATTATCGCGATGTAGTGATGGATGACCGAACTTCCACCCCATTGAAC
AACTTTAACACAATCGTCGACCTTCTTCAATGGCGAGTCGCTCGCCAAGCTGAAGAATTGGCTTACTGCTCTATC
GATAGCCGTGGAAAGGAAGGAAAAGGCGTCACCTGGAAGAAGTTTGACCTCAAAGTTTCTGCGGTGGCGACCTAC
CTCAAGAACAAGGTGAAGGTGCGACCAGGAGATCATCTCGTGCTGATGTACACCCACTCGGAAGAGTACGTCTAT
GCCGTCCATGCTTGTCTGTGCTTGGGTGCCGTTGTCATCCCGATGGCTCCTATTGATCAAAACCGTCTTTCGGAG
GATGCTCCTGCATTCTTGCACGTCATCGGCGACTTCAACATCAAGGCCATCATTGTCAATAACGATGTTGACCAT
GTCATGAGGCAGAAGCTTGTGTCGCAGCATATCAAGCAGTCCGCCCAGGTTCTTCGCATTGGTGTTCCTGCTATA
TACAATACCACAAAGCCCTCGAAGCAGTCCCACGGATGTCGCGAGCTCGGCTACACTGTGAAGGATACTTGGCTC
CAGGGTAACCAGCCTGCTATGGTCTGGACTTATTGGACCCCAGATCAGCGAAGAATCTCGGTGCAAATTTCCCAT
GAAACCATAATGGGCATGTGCAAGGTTCAAAAAGAAACCTGCCAAATGACAAGCTCAAGGCCGGTGCTTGGAAGT
GTTCGAAGTACCCTGGGTCTCGGATTCCTCCACACCTGCTTGATGGGCATTTACGTCGGTGCGCCTACATATCTA
GTTTCACCAGTCGATTTCGCTCAAAACCCATTGACTCTCTTCGTAACCCTTGCTCGGTACAAGATCAAGGACACT
TACGCCACCAGTCAGATGTTGGATTACGCAATGAGTGCTATGGCTGGAAAAGGCTTCCAGCTTCAAGAACTGAAG
AACCTGATGATTTCCGCAGAGGGGCGGCCTAGAACGGATCTCTATGGAAAGGTACGCCTACATTTCGCCAATGCC
AGCTTGGACCGTACCTCGATCAACGTCATTTACTCGCACGTTCTCAACCCGATGGTTACCACACGATCATACATG
TGCATTGAGCCGATCGAACTATGGCTCGACTTGCGAAGCCTCCGTCAAGGTCTTATTTACCCCGTAGACCCCGAT
GCCGATCCTACCGCGCTTTTGCTGCAGGATTCGGGCATGGTCCCAGTTAACACACAGATTGCGATCGTGAACCCG
GAGACCTGCACTCTCTCGCACGTTGGAGAGTACGGTGAGATCTGGGTCCAGTCCGACGCTTGCGCTGAGGGGTTC
TACAAATCAAAGCAAGAATTTGACTCCGAGCGGTTGAACGGCAGAGTTGCAGACGGTGACCCCAGCGTGCCTTAT
GTCCGTACTGGTGATCTTGGTTTCCTTCACACCGTTACTCGGCCGATCGGTCCTGGCGGCCAGCCAGTTGATATG
CAAGTCCTCTTCCTCCTCGGCAGTATCGGCGAAACTTTTGAAGTCAATGGACTCAATCACTTCCCTATGGACATT
GAAAACTCCGTAGAGAGTTGCCACCGCAATATCGTGAATGGAGGATGTGCTATTTTCCAAGCCGGTGGCTTGGTC
GTTGTTGTCGTTGAAGTTACCCGAAAAGCCTATCTAGCGGCCCTGGTCCCCGTCATTGTTGATGTTATCCTCATG
GAGCACCAAGTCGTTGCGGATATTGTCGCATTCGTCTCCCACGGCGACTTCCCCCGCTCTCGTCTAGGCGAGAAG
CAGCGCGGCAAGGTTCTCGCCTCATGGGTAACCCGGAAGCTGCGAACCATTGCTCAGTTCAGTATTCGCGACCTG
GAGGGCGATAGCCCATTTGCGGACATACCTCAGCACCGGATGAGCAGAGTTTCCAAGGCTGGAAGCACCATGGGC
ACCAGCATCCGACAGTCCACAATGAATCCGGATATCGACGCAAATGTCCCTCGCTCTCTACGTGGGGTGACATTG
GAAGAGACCAGTCATCCCGCGGCTACTTATCAGACCGGCCAAGCCGGGTCTGTGCCGTATGAACTGGGGAGTGTT
ACTGACAATAGTCCTCTTGCCACTCCTATCCCCGGGCCTAGCTCTGCTGTGCCTCACATCAAGGAGCCACAGTCT
GCCACGGTCGTAGCCGAGTTTGATGATCAACACTACAACACGTTGGATCCCACCGCGGGTACGTCCGCCGTGGAC
CGTGATTTCCGGTTCAGTTTTGATATGGCCGACAACCCTGACCAGTCTCAATCGTATGGACACCCTGGCGATGAA
CGGCCCTCGACGGGACGAGAGCCGCTTCCTAGCCAACAGGGATGGAACCCCAACAGCCCCCAGGCTGCTAGCACA
CCCCCTGCTGAGACGGCACGTCCAAGCACACAGGACAGTGGGGTCAATGATTGGCCCCAAGAAGCTCTCATGTAC
CAGTCGGCACTAGGCGCAGAAGACGGGCATGACGTTGGCCGCACAGACAGCGACAATTCTGCACCGCCAAATCGG
CAACTACGAGGCTTGAACTTGGATTGA
Gene >Pro_DTO377G3_2|g871.t1
ATGGCGGAAGAGTCTCCCGAGATACAGGCCGCTTTGCGGGACCTAGATCGGGAATTGGAGGTATGTACATCTCGT
GCACTTGTTGTATGCTTTTTCTTATGTATGATCCATGACAGGAGGGCGATATCACTCAAAAAGGGTAAGCTATCC
CTGGCTACAACCAGTATTACAAGCCAATTGTGCCTTGTCATAGATTTGGTTCTTGCGACAGAGATTTCTGGACCA
GCAGATGCATAGGACTGACAACGACAAGATACCAGAAGCGACGTACGATCCTGCTTTCGCAATATTTCGGTCCCA
ACAAGCCCCTTGATATCAATTCACAGGCCGGTCTTGGCTACGATGCATCCCCAACCAGCCCTGGAAGGGTCCCGC
CGGCCATTCTGAGCGTTCGCCCACCAACTGCCGATTCTTCCCTGCCACACGTCACTTCCCCCATTTACGCAGGCA
GTCATGGCTCACAGGGCAGCGGAGCCGTCGGATATGATCAAGGTGCCGGTATAAATACACAGGATCAGTCGCATG
CATCGCTAGGGTCTCATCGTAGAGAAAGCATGCTCCAAGCTCATGACCGCGCGCCTTCAGGGAGCTCTTACGACT
CCCTCTTCCTTCCTAAACCCCCAGCCCCAGGGTTACAAGGCCAGGATGGTTCCAGAACCGCAACTTTAATGAGTC
AGAACTACGCGTTCAATCCAAATTCTCAGCCCGAATATATGTCTCAGCCCGAGTACGCTCAGGAGTACCCTCAGG
AGTACCCTCAGGAGTACGCTCAGGAATATCCTCAGGAGTATACCCCCGCCGAACCTGAGTACGCGGACGAGGGCA
TGGCATATTACGATCCAGCATCTGGAGCGCCCACGCGACAGTCCACGATGCTTGATTCCCAGCAGGGCTACTTTT
CCGACTTTGCGGGGCAACAGCATGATGATTATAGGGATAGCTATGGAGGTGGCTTCCACCGCTATTCTCAGTCCG
GGGAAGCCTTTTCGCCAACAGCAAACATGGCCCCGCCATTGATGCCTGCTGGGGCGGAACTTCAGCACGGACCGG
CTATTGAGCATCTACTTCCCCTCGAACCTCGAGAGATTCCTTTCTCATTGAACGATCCGCACGACAAAAATGTCC
CCATGTCGAACTTTGACAACCTGCCCGCGGTGTTACGGCATCGTGCTCGGGCTCACCCCAAGCAAGCAGCATATT
GGGTGCTGGATGCAAAGGGCAAGGAGGTTGCATCGATAACGTGGGAAAAACTGTCTAGTCGCGCCGAGAAAGTTG
CTCAGGTTATTCGCGATAAGAGTAATCTATATCGCGGAGATCGTGTCGCTCTCATCTACCGCGAAGCTGAAATTA
TCGAGTTCGCTGTCGCGCTCTTGGGCTGCTTTATTGCAGGAGTTGTCGCCGTGCCTATCAACAGTCTGGATGATT
ACACAAGTCTAAATATTGTGCTCACCTCAACGCAGGCACATCTGGCATTGACAACTGAGAATAACCTGAAGAACT
TCCAACGCGATATCACAGCTCAAAAACTCAGTTGGCCACGAGGAGTCGAGTGGTGGAAGACGAATGAGTTCGGCA
GTTTCCATCCAAAGAAGAAGGACGATACACCTGCGCTGCAGGTCCCCGATCTGGCCTATATTGAGTTTGCGAGGG
CCCCGACGGGTGATATGCGTGGTGTTGTGATGAGCCACCGGACTATCATGCATCAAATGGCATGTCTGAGTGCGA
TCATTTCTACAGTTCCTGTGGAGTCAAGCGCTAGGCAATATAGCACTAAGGGAGAGACGATCATCAGTTACCTCG
ATCCGAGACAAGGAATTGGTATGATCATGGCCATTCTCTTCACCGTTTACGGTGGCCATACAACCGTTTGGCACG
AGGACCGGGCTGTGGAAACACCCGGTTTATATGCCCATCTCATCACCAAATACAAGGCATCAGTCATGGCGACCG
ATTACTCTGGCTTGAAGATCGCCACCTACAACTACCAGCAAGATCCGATGGCCACAAGACATTTTAAGAAAAACT
CGGAACCTAATTTCAGCAGCGTCAAACTCTGTCTCATCGATACGCTTACTCTCGACCCTGAGTTCCATGAAATCC
TGGCAGACAGATGGCTTCGGCCAATGAGGAACCCACGGGCTAGAGAAATTGTGGCTCCGATGCTCTGCTTACCAG
AGCATGGAGGTATGGTCATTAGTATGCGTGACTGGCTCGGTGGTGAAGAGCGAATGGGATGTTCCTTGACCCATG
AAATGGACCCAGCCGGCCGCGATGATTATAAGAAAGAGGACGAGAGCCTTACCAAGTCTGAGACTAAAACGGGCT
TCGGAAGCAGTCTTCTGGGTGGTGGATCACGAGTTTCTACGATCAAGCAGAGCCCTAAAAACGAGCTTAGCGAGG
TGCTTCTAGACAAAGAGGCATTAAAGAGCAATGAAGTGGTTGTGCTAGCCATGGGCGAGGATGCACGAAAGTATG
CCAGCAGTATGCCGCATGCTGTACGCGTTGGCGCTTTCGGCTACCCAATTCCTGACGCAACTCTCGCTGTCGTTG
ATCCGGAGACCAATCTCCTTTGTACGCCAAATGTTATTGGAGAGATTTGGGTTGATTCACCCTCTCTTTCTGGTG
GCTTCTGGGCATTGCCGAAACACACAGAGGCCATATTCCACGCTCGCCCCTACAAATTCGAGGAGCCTAACCCGA
CCCCGATACTCGTGGAACCTGAATTCCTGCGCACTGGTCTACTTGGATGTGTGATTGAGGGCCGACTTTTCGTGC
TTGGTCTCTACGAGGATCGTCTCCGCCAAAAAGTCGAATGGGTTGAGCACGGCCAAGAGATTGTGGAACATCGAT
ACTTCTTCGTTCAACATCTAACAGTTAGCATTCTTAAGAAGGTGCCGAAAATTCATGATTGTACTGCGTTCGATG
TGTTTGTTAACGAAGAACATCTTCCTGTGATTATTTTGGAGTCTTACTCGGCCTCAACGGCGCCAACAACTTCCG
GCGGTCCGCCAAGGCAGCTCGACTCGGTTCTTCTTGATTCGCTCGCCGACAGGTGTATGGAGGTACTATACCAAG
AGCATCATCTACGGGTATACTGTGTTCTACTTACAGCCCCGAACAGTCTGCCGCGCGTTACCAAGAATGGCAGAC
AAGAAATTGGCAACATGCTCTGTCGCAAAGATTTCGAGTGCGGTATGCTGCAAGCAGTGCATGTTAAGTTTGGAG
TTGAACGATCAGTGATGAACCTGCCCGTCGGTGTTGATCCTGAGGGTGGAATCTGGTCCCCCACTGCTCTAGCAT
CACGACAAGACTTGCTTGCCTACCAGGAAAAGCAATATTCGGGTGTGGATTATCGCGATGTAGTGATGGATGACC
GAACTTCCACCCCATTGAACAACTTTAACACAATCGTCGACCTTCTTCAATGGCGAGTCGCTCGCCAAGCTGAAG
AATTGGCTTACTGCTCTATCGATAGCCGTGGAAAGGAAGGAAAAGGCGTCACCTGGAAGAAGTTTGACCTCAAAG
TTTCTGCGGTGGCGACCTACCTCAAGAACAAGGTGAAGGTGCGACCAGGAGATCATCTCGTGCTGATGTACACCC
ACTCGGAAGAGTACGTCTATGCCGTCCATGCTTGTCTGTGCTTGGGTGCCGTTGTCATCCCGATGGCTCCTATTG
ATCAAAACCGTCTTTCGGAGGATGCTCCTGCATTCTTGCACGTCATCGGCGACTTCAACATCAAGGCCATCATTG
TCAATAACGATGTTGACCATGTCATGAGGCAGAAGCTTGTGTCGCAGCATATCAAGCAGTCCGCCCAGGTTCTTC
GCATTGGTGTTCCTGCTATATACAATACCACAAAGCCCTCGAAGCAGTCCCACGGATGTCGCGAGCTCGGCTACA
CTGTGAAGGATACTTGGCTCCAGGGTAACCAGCCTGCTATGGTCTGGACTTATTGGACCCCAGATCAGCGAAGAA
TCTCGGTGCAAATTTCCCATGAAACCATAATGGGCATGTGCAAGGTTCAAAAAGAAACCTGCCAAATGACAAGCT
CAAGGCCGGTGCTTGGAAGTGTTCGAAGTACCCTGGGTCTCGGATTCCTCCACACCTGCTTGATGGGCATTTACG
TCGGTAAGTTTGCTGCTAATCTATGAACATCTCCACCCTAACATATTATTCAGGTGCGCCTACATATCTAGTTTC
ACCAGTCGATTTCGCTCAAAACCCATTGACTCTCTTCGTAACCCTTGCTCGGTACAAGATCAAGGACACTTACGC
CACCAGTCAGATGTTGGATTACGCAATGAGTGCTATGGCTGGAAAAGGCTTCCAGCTTCAAGAACTGAAGAACCT
GATGATTTCCGCAGAGGGGCGGCCTAGAACGGATCTCTGTATGTGTCGTCACCATCAGAGCCATGAAGAGAAGCT
AATCCGATTATACAGATGGAAAGGTACGCCTACATTTCGCCAATGCCAGCTTGGACCGTACCTCGATCAACGTCA
TTTACTCGCACGTTCTCAACCCGATGGTTACCACACGATCATACATGTGCATTGAGCCGATCGAACTATGGCTCG
ACTTGCGAAGCCTCCGTCAAGGTCTTATTTACCCCGTAGACCCCGATGCCGATCCTACCGCGCTTTTGCTGCAGG
ATTCGGGCATGGTCCCAGTTAACACACAGATTGCGATCGTGAACCCGGAGACCTGCACTCTCTCGCACGTTGGAG
AGTACGGTGAGATCTGGGTCCAGTCCGACGCTTGCGCTGAGGGGTTCTACAAATCAAAGCAAGAATTTGACTCCG
AGCGGTTGAACGGCAGAGTTGCAGACGGTGACCCCAGCGTGCCTTATGTCCGTACTGGTGATCTTGGTTTCCTTC
ACACCGTTACTCGGCCGATCGGTCCTGGCGGCCAGCCAGTTGATATGCAAGTCCTCTTCCTCCTCGGCAGTATCG
GCGAAACTTTTGAAGTCAATGGACTCAATCACTTCCCTATGGACATTGAAAACTCCGTAGAGAGTTGCCACCGCA
ATATCGTGAATGGAGGATGGTAAGTAGATGATAATCTATTGAGATCTGACCTGGAGGCTAACATTCTCAGTGCTA
TTTTCCAAGCCGGTGGCTTGGTCGTTGTTGTCGTTGAAGTTACCCGAAAAGCCTATCTAGCGGCCCTGGTCCCCG
TCATTGTTGATGTTATCCTCATGGAGCACCAAGTCGTTGCGGATATTGTCGCATTCGTCTCCCACGGCGACTTCC
CCCGCTCTCGTCTAGGCGAGAAGCAGCGCGGCAAGGTTCTCGCCTCATGGGTAACCCGGAAGCTGCGAACCATTG
CTCAGTTCAGTATTCGCGACCTGGAGGGCGATAGCCCATTTGCGGACATACCTCAGCACCGGATGAGCAGAGTTT
CCAAGGCTGGAAGCACCATGGGCACCAGCATCCGACAGTCCACAATGAATCCGGATATCGACGCAAATGTCCCTC
GCTCTCTACGTGGGGTGACATTGGAAGAGACCAGTCATCCCGCGGCTACTTATCAGACCGGCCAAGCCGGGTCTG
TGCCGTATGAACTGGGGAGTGTTACTGACAATAGTCCTCTTGCCACTCCTATCCCCGGGCCTAGCTCTGCTGTGC
CTCACATCAAGGAGCCACAGTCTGCCACGGTCGTAGCCGAGTTTGATGATCAACACTACAACACGTTGGATCCCA
CCGCGGGTACGTCCGCCGTGGACCGTGATTTCCGGTTCAGTTTTGATATGGCCGACAACCCTGACCAGTCTCAAT
CGTATGGACACCCTGGCGATGAACGGCCCTCGACGGGACGAGAGCCGCTTCCTAGCCAACAGGGATGGAACCCCA
ACAGCCCCCAGGCTGCTAGCACACCCCCTGCTGAGACGGCACGTCCAAGCACACAGGACAGTGGGGTCAATGATT
GGCCCCAAGAAGCTCTCATGTACCAGTCGGCACTAGGCGCAGAAGACGGGCATGACGTTGGCCGCACAGACAGCG
ACAATTCTGCACCGCCAAATCGGCAACTACGAGGCTTGAACTTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail