Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8705.t1
Gene name
Locationscaffold_36:78092..84710
Strand+
Gene length (bp)6618
Transcript length (bp)4026
Coding sequence length (bp)4026
Protein length (aa) 1342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 6.3E-12 456 702
PF00083 Sugar_tr Sugar (and other) transporter 1.0E-92 855 1294
PF07690 MFS_1 Major Facilitator Superfamily 7.4E-39 447 807
PF07690 MFS_1 Major Facilitator Superfamily 8.0E-24 879 1238
PF01490 Aa_trans Transmembrane amino acid transporter protein 3.2E-38 51 441

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 80 102 22
3 136 158 22
4 168 187 19
5 194 216 22
6 236 258 22
7 270 292 22
8 307 329 22
9 350 369 19
10 384 406 22
11 419 441 22
12 456 478 22
13 485 502 17
14 512 534 22
15 547 569 22
16 579 601 22
17 651 673 22
18 688 710 22
19 731 750 19
20 755 777 22
21 798 820 22
22 824 846 22
23 919 941 22
24 945 964 19
25 976 998 22
26 1008 1030 22
27 1097 1119 22
28 1134 1156 22
29 1163 1185 22
30 1195 1217 22
31 1229 1248 19
32 1258 1280 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8705.t1
MADYRHYPLSNDVDNRSYAAEKEEENRSGDVISHLADPFGDEHDAEIKYRTLQWWQCGMIMIAETVSLGILSLPS
AVAVLGLVPAIILIVGLGIVATYTGYVIGQFKLRYPQVHSMGDAGEVMFHPLGLARFGREFLGTAQLLFLIFVMG
SHILTFSVMLDTVTDHGTCSIVFGIVGLVVSFVFALPRTLRKVSWFSFASFASIIAALLITMIAIAIQRPGDGKV
DATTTVSLSKAFLAVTNIVFAYAGHVAFFGFISEMETPTDYPKTLYMLQITDTSMYVIAAVVIYIYGGKDVQSPA
LSSTKPITAKIAYGIAIPTIVIAGVINGHVASKYVYVRLFRNTNHMKQRTFLSIGSWVAISLVLWVIAWIISEAI
PVFNTLLSLITSLFASWFTYGLSGIFWLFLNRGQYGASWKKMVLTVVNLVVIGIGACLCGMGLWVSATRQTATKF
GVSMEVTLLAVSLFVLGFAFGPIIFGPLSELYGRKLPLFLGMFGFAIFQIPVAVAENLHTIFICRFLGGTFASAP
LAIVNGILADMFEPVERGIAMAVFAAAAFIGPVAGPIVGGFITISYLGWRWTEYITAIWAFAISSIGILVVPETF
EQTLLTQRAKRLRTKSKNWALHAKAEEKVVSYQDIAVQYLLRPFQMLVQEPILLLITLYMGFIYGFLYTCFVAYP
VSFQEQRGWNDGIGALPFVAFICGVFCGCLIIIAFSLTRYRTFILRNGRVQPEERLIPMIIGGILLPVGMFWFGW
TSDPHIIWVPQVISGAFLGSGVLLIFLQGLTYIVDVYPMYTNSAMAANSFFRSWLGAGFPMFAPPLFHNLGVDWA
MTLLGCLTVALFPVPIAFFIYGPKIRSWSVMGGLLTLESFAETFPQMNTLTATAAQEKYNSTIQGTVVALYTVGG
IFGSLSCIQFGDRLGRRKVILFTSFISIIGAVLMATSFSLAQFIVARLVLGYGTGGYVATVPVWQSEISKPSKRG
AHVVTDGIFIGAGIAFSLWVDFGFYFVKTNSVSWRFPLVFQVLLSLMVMSFVMLFPESPRWLIKRGRSEEAREIL
AALDDVDPHSEQITLDIRDIETSLAISGTGSWKDMLKMGEQRLFHRTVLACMGQMFQQMCGINLITFYATTIFEQ
YLKLSPIQSRVLAASMCLTQPLGGLLAYFTIDRLGRRVLMLWSAVGMSISMAILAGTTSVQDNTGSLVCAVVFLF
VFEFIFTVGYSGLTFLYATEVAPLQCRASISAVSAAAVWTFNFLLAEVTPVGFATIDYQYYIIFAVLNAAIVPTV
YFFFPETSGRSLEEIDEIFLQSRSIFDPPRIARSLPRMHVADPHGLDLDAKDVGSGDEATGEKPKV*
Coding >Pro_DTO377G3_2|g8705.t1
ATGGCAGATTATCGCCATTATCCTCTCTCAAATGACGTCGACAACAGGAGTTATGCTGCAGAGAAAGAAGAGGAG
AACCGATCGGGGGATGTGATCTCTCACCTCGCAGACCCATTTGGGGATGAACATGATGCCGAAATTAAGTATCGG
ACGTTACAATGGTGGCAATGCGGCATGATCATGATCGCGGAGACCGTCTCCCTCGGTATTCTGTCTCTTCCGTCG
GCTGTCGCAGTCCTAGGTCTGGTGCCTGCGATCATTCTTATTGTCGGACTCGGTATAGTCGCAACGTACACTGGA
TATGTCATCGGCCAATTCAAACTCAGATACCCGCAAGTACATAGTATGGGAGATGCTGGCGAGGTGATGTTCCAT
CCTCTTGGTCTAGCTCGCTTTGGTAGGGAGTTCTTGGGAACGGCGCAACTGCTTTTTCTCATATTTGTCATGGGC
AGTCATATCTTGACTTTCAGTGTTATGTTGGATACAGTCACAGACCATGGGACTTGCTCGATTGTATTTGGGATC
GTTGGCTTAGTTGTCTCCTTCGTTTTTGCCTTGCCTCGAACTCTTCGCAAGGTTTCGTGGTTCTCGTTTGCTTCC
TTCGCAAGCATCATTGCCGCACTCCTGATTACTATGATCGCTATTGCTATCCAGCGCCCCGGTGATGGCAAAGTA
GATGCGACTACAACAGTCAGCCTGTCAAAGGCATTCTTAGCAGTGACGAATATTGTATTTGCTTATGCTGGGCAC
GTGGCTTTCTTCGGCTTTATTTCAGAGATGGAGACTCCAACGGACTATCCTAAGACCCTCTACATGCTCCAAATA
ACCGATACGAGTATGTATGTGATAGCTGCTGTTGTTATATATATCTACGGTGGGAAGGATGTGCAGTCACCCGCC
CTGAGCTCGACAAAGCCAATAACAGCAAAGATTGCATATGGAATTGCCATTCCTACGATTGTTATAGCCGGTGTT
ATCAACGGGCACGTCGCATCAAAATACGTTTACGTCCGTCTTTTCCGAAACACAAATCACATGAAGCAGCGCACA
TTCCTCTCGATCGGGTCCTGGGTTGCGATCAGTCTTGTGTTATGGGTGATAGCCTGGATTATTTCAGAGGCAATT
CCTGTTTTCAATACTTTGCTGAGTCTGATCACTTCCCTTTTTGCTAGCTGGTTTACCTATGGTCTGAGTGGTATA
TTCTGGCTGTTCCTGAATCGAGGCCAGTATGGGGCGTCCTGGAAAAAAATGGTTCTGACTGTTGTCAACCTGGTG
GTTATCGGGATTGGTGCTTGCTTGTGCGGCATGGGCCTTTGGGTTTCCGCAACGAGACAGACAGCGACAAAGTTC
GGCGTCTCCATGGAAGTCACGTTGTTGGCTGTCAGTTTGTTCGTTCTGGGCTTCGCCTTTGGCCCTATCATCTTT
GGCCCCCTTTCTGAACTGTACGGCCGGAAGCTACCGTTGTTTCTGGGCATGTTCGGCTTCGCAATCTTCCAGATT
CCCGTAGCCGTAGCCGAGAACTTGCACACTATCTTCATATGTCGCTTTCTGGGCGGAACCTTTGCCAGTGCACCT
CTTGCCATTGTAAATGGCATTTTGGCCGATATGTTCGAGCCCGTGGAGCGAGGGATTGCAATGGCCGTCTTCGCT
GCGGCAGCCTTCATCGGCCCGGTAGCAGGGCCAATCGTCGGTGGATTCATAACAATTTCATACCTGGGCTGGCGC
TGGACAGAGTACATTACAGCTATCTGGGCATTTGCTATCTCCAGCATCGGGATCCTGGTTGTCCCCGAGACGTTC
GAGCAAACTTTACTCACACAACGCGCTAAGCGACTTCGCACCAAATCCAAGAACTGGGCTCTTCATGCGAAGGCA
GAAGAAAAGGTAGTCAGTTATCAAGATATTGCAGTACAATATCTCCTGCGCCCGTTCCAGATGCTTGTGCAGGAA
CCCATTCTTCTGCTTATTACCTTGTACATGGGTTTCATATATGGCTTTCTGTACACTTGTTTTGTGGCCTATCCG
GTCTCCTTCCAAGAACAGCGTGGGTGGAATGATGGCATTGGAGCGTTGCCGTTCGTTGCTTTCATTTGTGGTGTC
TTTTGCGGTTGTTTGATTATCATTGCATTTTCATTGACGCGGTATCGAACGTTCATACTCCGCAATGGCCGAGTT
CAGCCAGAGGAGCGGTTGATTCCTATGATTATTGGAGGTATTTTGTTGCCCGTGGGGATGTTTTGGTTTGGCTGG
ACGTCAGATCCTCACATAATTTGGGTTCCACAAGTTATATCTGGGGCATTCTTGGGGTCGGGGGTATTATTGATC
TTCCTGCAGGGGCTGACTTATATCGTCGATGTGTATCCGATGTATACAAACTCTGCAATGGCAGCAAACTCCTTC
TTTCGGTCATGGCTGGGGGCTGGATTTCCGATGTTCGCACCACCATTGTTTCATAACTTGGGCGTCGACTGGGCG
ATGACTTTGCTAGGTTGTCTGACCGTCGCGTTGTTCCCTGTGCCCATTGCGTTTTTCATATATGGGCCGAAAATA
CGCTCATGGAGTGTGATGGGAGGTCTGTTGACCCTGGAATCCTTCGCCGAGACCTTTCCGCAGATGAACACTCTC
ACTGCAACCGCCGCACAAGAGAAGTATAACTCGACTATTCAAGGCACGGTAGTCGCACTATATACCGTTGGTGGA
ATTTTTGGTTCACTATCATGCATTCAATTCGGTGACAGGCTCGGCCGCCGGAAGGTCATCCTGTTCACCTCCTTC
ATTTCGATAATTGGCGCTGTCTTGATGGCAACGTCCTTTTCACTTGCACAATTTATCGTTGCACGACTCGTCCTC
GGATATGGAACTGGCGGTTACGTGGCTACAGTACCCGTCTGGCAGTCCGAGATCTCAAAGCCCAGCAAGCGTGGT
GCTCACGTAGTAACTGACGGCATCTTCATCGGTGCCGGTATCGCCTTCTCTCTCTGGGTCGACTTCGGCTTTTAC
TTCGTTAAGACCAACTCGGTTTCCTGGCGATTCCCCTTGGTCTTCCAGGTCCTGCTATCACTAATGGTCATGAGC
TTTGTGATGCTCTTCCCCGAATCGCCCCGATGGCTGATCAAAAGAGGTCGCAGCGAGGAGGCGCGCGAGATTTTG
GCGGCGCTGGACGACGTCGACCCTCATTCGGAACAGATCACTCTCGATATTCGCGATATTGAGACCTCCCTAGCT
ATTTCCGGAACCGGTTCGTGGAAGGATATGCTGAAGATGGGCGAGCAGCGACTCTTCCATCGCACCGTTCTCGCC
TGTATGGGTCAAATGTTTCAGCAGATGTGCGGAATCAATCTAATCACTTTCTACGCCACGACCATTTTCGAACAA
TATCTCAAGCTCTCTCCCATCCAGTCGCGTGTCCTGGCCGCATCCATGTGCCTAACACAGCCGCTGGGCGGCCTG
CTGGCCTATTTTACCATCGACCGTCTCGGTCGCCGCGTGCTCATGCTGTGGAGTGCTGTCGGGATGTCAATCTCT
ATGGCCATCCTGGCTGGCACCACTTCCGTCCAAGATAACACCGGCAGCTTGGTCTGCGCCGTCGTGTTCCTTTTC
GTCTTCGAATTCATCTTCACAGTCGGATACTCCGGCTTGACCTTCCTGTACGCCACAGAGGTCGCTCCCCTCCAG
TGTCGAGCATCTATCAGCGCCGTCTCCGCGGCCGCCGTCTGGACTTTTAACTTCCTCCTCGCTGAGGTCACGCCC
GTCGGCTTCGCTACCATCGACTACCAGTACTATATTATCTTCGCTGTGCTGAACGCCGCCATCGTGCCGACTGTG
TATTTCTTCTTCCCGGAGACTAGCGGCCGCAGCCTCGAGGAAATCGATGAGATCTTCTTGCAGTCGCGCAGTATA
TTCGATCCGCCTCGCATTGCTCGCTCGCTTCCCCGAATGCACGTTGCCGATCCTCATGGGTTGGATCTCGACGCC
AAGGATGTTGGAAGCGGTGATGAGGCCACGGGCGAGAAGCCCAAAGTGTAA
Transcript >Pro_DTO377G3_2|g8705.t1
ATGGCAGATTATCGCCATTATCCTCTCTCAAATGACGTCGACAACAGGAGTTATGCTGCAGAGAAAGAAGAGGAG
AACCGATCGGGGGATGTGATCTCTCACCTCGCAGACCCATTTGGGGATGAACATGATGCCGAAATTAAGTATCGG
ACGTTACAATGGTGGCAATGCGGCATGATCATGATCGCGGAGACCGTCTCCCTCGGTATTCTGTCTCTTCCGTCG
GCTGTCGCAGTCCTAGGTCTGGTGCCTGCGATCATTCTTATTGTCGGACTCGGTATAGTCGCAACGTACACTGGA
TATGTCATCGGCCAATTCAAACTCAGATACCCGCAAGTACATAGTATGGGAGATGCTGGCGAGGTGATGTTCCAT
CCTCTTGGTCTAGCTCGCTTTGGTAGGGAGTTCTTGGGAACGGCGCAACTGCTTTTTCTCATATTTGTCATGGGC
AGTCATATCTTGACTTTCAGTGTTATGTTGGATACAGTCACAGACCATGGGACTTGCTCGATTGTATTTGGGATC
GTTGGCTTAGTTGTCTCCTTCGTTTTTGCCTTGCCTCGAACTCTTCGCAAGGTTTCGTGGTTCTCGTTTGCTTCC
TTCGCAAGCATCATTGCCGCACTCCTGATTACTATGATCGCTATTGCTATCCAGCGCCCCGGTGATGGCAAAGTA
GATGCGACTACAACAGTCAGCCTGTCAAAGGCATTCTTAGCAGTGACGAATATTGTATTTGCTTATGCTGGGCAC
GTGGCTTTCTTCGGCTTTATTTCAGAGATGGAGACTCCAACGGACTATCCTAAGACCCTCTACATGCTCCAAATA
ACCGATACGAGTATGTATGTGATAGCTGCTGTTGTTATATATATCTACGGTGGGAAGGATGTGCAGTCACCCGCC
CTGAGCTCGACAAAGCCAATAACAGCAAAGATTGCATATGGAATTGCCATTCCTACGATTGTTATAGCCGGTGTT
ATCAACGGGCACGTCGCATCAAAATACGTTTACGTCCGTCTTTTCCGAAACACAAATCACATGAAGCAGCGCACA
TTCCTCTCGATCGGGTCCTGGGTTGCGATCAGTCTTGTGTTATGGGTGATAGCCTGGATTATTTCAGAGGCAATT
CCTGTTTTCAATACTTTGCTGAGTCTGATCACTTCCCTTTTTGCTAGCTGGTTTACCTATGGTCTGAGTGGTATA
TTCTGGCTGTTCCTGAATCGAGGCCAGTATGGGGCGTCCTGGAAAAAAATGGTTCTGACTGTTGTCAACCTGGTG
GTTATCGGGATTGGTGCTTGCTTGTGCGGCATGGGCCTTTGGGTTTCCGCAACGAGACAGACAGCGACAAAGTTC
GGCGTCTCCATGGAAGTCACGTTGTTGGCTGTCAGTTTGTTCGTTCTGGGCTTCGCCTTTGGCCCTATCATCTTT
GGCCCCCTTTCTGAACTGTACGGCCGGAAGCTACCGTTGTTTCTGGGCATGTTCGGCTTCGCAATCTTCCAGATT
CCCGTAGCCGTAGCCGAGAACTTGCACACTATCTTCATATGTCGCTTTCTGGGCGGAACCTTTGCCAGTGCACCT
CTTGCCATTGTAAATGGCATTTTGGCCGATATGTTCGAGCCCGTGGAGCGAGGGATTGCAATGGCCGTCTTCGCT
GCGGCAGCCTTCATCGGCCCGGTAGCAGGGCCAATCGTCGGTGGATTCATAACAATTTCATACCTGGGCTGGCGC
TGGACAGAGTACATTACAGCTATCTGGGCATTTGCTATCTCCAGCATCGGGATCCTGGTTGTCCCCGAGACGTTC
GAGCAAACTTTACTCACACAACGCGCTAAGCGACTTCGCACCAAATCCAAGAACTGGGCTCTTCATGCGAAGGCA
GAAGAAAAGGTAGTCAGTTATCAAGATATTGCAGTACAATATCTCCTGCGCCCGTTCCAGATGCTTGTGCAGGAA
CCCATTCTTCTGCTTATTACCTTGTACATGGGTTTCATATATGGCTTTCTGTACACTTGTTTTGTGGCCTATCCG
GTCTCCTTCCAAGAACAGCGTGGGTGGAATGATGGCATTGGAGCGTTGCCGTTCGTTGCTTTCATTTGTGGTGTC
TTTTGCGGTTGTTTGATTATCATTGCATTTTCATTGACGCGGTATCGAACGTTCATACTCCGCAATGGCCGAGTT
CAGCCAGAGGAGCGGTTGATTCCTATGATTATTGGAGGTATTTTGTTGCCCGTGGGGATGTTTTGGTTTGGCTGG
ACGTCAGATCCTCACATAATTTGGGTTCCACAAGTTATATCTGGGGCATTCTTGGGGTCGGGGGTATTATTGATC
TTCCTGCAGGGGCTGACTTATATCGTCGATGTGTATCCGATGTATACAAACTCTGCAATGGCAGCAAACTCCTTC
TTTCGGTCATGGCTGGGGGCTGGATTTCCGATGTTCGCACCACCATTGTTTCATAACTTGGGCGTCGACTGGGCG
ATGACTTTGCTAGGTTGTCTGACCGTCGCGTTGTTCCCTGTGCCCATTGCGTTTTTCATATATGGGCCGAAAATA
CGCTCATGGAGTGTGATGGGAGGTCTGTTGACCCTGGAATCCTTCGCCGAGACCTTTCCGCAGATGAACACTCTC
ACTGCAACCGCCGCACAAGAGAAGTATAACTCGACTATTCAAGGCACGGTAGTCGCACTATATACCGTTGGTGGA
ATTTTTGGTTCACTATCATGCATTCAATTCGGTGACAGGCTCGGCCGCCGGAAGGTCATCCTGTTCACCTCCTTC
ATTTCGATAATTGGCGCTGTCTTGATGGCAACGTCCTTTTCACTTGCACAATTTATCGTTGCACGACTCGTCCTC
GGATATGGAACTGGCGGTTACGTGGCTACAGTACCCGTCTGGCAGTCCGAGATCTCAAAGCCCAGCAAGCGTGGT
GCTCACGTAGTAACTGACGGCATCTTCATCGGTGCCGGTATCGCCTTCTCTCTCTGGGTCGACTTCGGCTTTTAC
TTCGTTAAGACCAACTCGGTTTCCTGGCGATTCCCCTTGGTCTTCCAGGTCCTGCTATCACTAATGGTCATGAGC
TTTGTGATGCTCTTCCCCGAATCGCCCCGATGGCTGATCAAAAGAGGTCGCAGCGAGGAGGCGCGCGAGATTTTG
GCGGCGCTGGACGACGTCGACCCTCATTCGGAACAGATCACTCTCGATATTCGCGATATTGAGACCTCCCTAGCT
ATTTCCGGAACCGGTTCGTGGAAGGATATGCTGAAGATGGGCGAGCAGCGACTCTTCCATCGCACCGTTCTCGCC
TGTATGGGTCAAATGTTTCAGCAGATGTGCGGAATCAATCTAATCACTTTCTACGCCACGACCATTTTCGAACAA
TATCTCAAGCTCTCTCCCATCCAGTCGCGTGTCCTGGCCGCATCCATGTGCCTAACACAGCCGCTGGGCGGCCTG
CTGGCCTATTTTACCATCGACCGTCTCGGTCGCCGCGTGCTCATGCTGTGGAGTGCTGTCGGGATGTCAATCTCT
ATGGCCATCCTGGCTGGCACCACTTCCGTCCAAGATAACACCGGCAGCTTGGTCTGCGCCGTCGTGTTCCTTTTC
GTCTTCGAATTCATCTTCACAGTCGGATACTCCGGCTTGACCTTCCTGTACGCCACAGAGGTCGCTCCCCTCCAG
TGTCGAGCATCTATCAGCGCCGTCTCCGCGGCCGCCGTCTGGACTTTTAACTTCCTCCTCGCTGAGGTCACGCCC
GTCGGCTTCGCTACCATCGACTACCAGTACTATATTATCTTCGCTGTGCTGAACGCCGCCATCGTGCCGACTGTG
TATTTCTTCTTCCCGGAGACTAGCGGCCGCAGCCTCGAGGAAATCGATGAGATCTTCTTGCAGTCGCGCAGTATA
TTCGATCCGCCTCGCATTGCTCGCTCGCTTCCCCGAATGCACGTTGCCGATCCTCATGGGTTGGATCTCGACGCC
AAGGATGTTGGAAGCGGTGATGAGGCCACGGGCGAGAAGCCCAAAGTGTAA
Gene >Pro_DTO377G3_2|g8705.t1
ATGGCAGATTATCGCCATTATCCTCTCTCAAATGACGTCGACAACAGGAGTTATGCTGCAGAGAAAGAAGAGGAG
AACCGATCGGGGGATGTGATCTCTCACCTCGCAGACCCATTTGGGGATGAACATGATGCCGAAATTAAGTATCGG
ACGTTACAATGGTGGCAATGCGGCATGATCATGATCGCGGAGACCGTCTCCCTCGGTATTCTGTCTCTTCCGTCG
GCTGTCGCAGTCCTAGGTCTGGTGCCGTACGTTTCTACTACCTCTGATGCACAGAATAGGAATCCGCTGACTGCT
TTCCAGTGCGATCATTCTTATTGTCGGACTCGGTATAGTCGCAACGTACACTGGATATGTCATCGGCCAATTCAA
ACTCAGATACCCGCAAGTACATAGTATGGGAGATGCTGGCGAGGTGATGTTCCATCCTCTTGGTCTAGCTCGCTT
TGGTAGGGAGTTCTTGGGAACGGCGCAACTGCTTTTTCTCATATTTGTCATGGGCAGTCATATCTTGACTTTCAG
TGTTATGTTGGATACAGTCACAGACCATGGGACTTGCTCGATTGTATTTGGGATCGTTGGCTTAGTTGTCTCCTT
CGTTTTTGCCTTGCCTCGAACTCTTCGCAAGGTTTCGTGGTTCTCGTTTGCTTGTATGTATATCCAAATCTTTTC
AGAACCAGCCCCTTTCTAACTCTCACAGCCTTCGCAAGCATCATTGCCGCACTCCTGATTACTATGATCGCTATT
GCTATCCAGCGCCCCGGTGATGGCAAAGTAGATGCGACTACAACAGTCAGCCTGTCAAAGGCATTCTTAGCAGTG
ACGAATATTGTATTTGCTTATGGTGAGTACTAATCAGCTACCCTGACCTTGAAACTAATCTTTATCTAGCTGGGC
ACGTGGCTTTCTTCGGCTTTATTTCAGAGATGGAGACTCCAACGGACTATCCTAAGACCCTCTACATGCTCCAAA
TAACCGATACGAGTATGTATGTGATAGCTGCTGTTGTTATATATATCTACGGTGGGAAGGATGTGCAGTCACCCG
CCCTGAGCTCGACAAAGCCAATAACAGCAAAGATTGCATATGGAATTGCCATTCCTACGGTGCGAGCCTCCAGCC
CATGTTTGATTTATGCAGCATCCTAATGTGATATTATAGATTGTTATAGCCGGTGTTATCAACGGGCACGTCGCA
TCAAAATACGTTTACGTCCGTCTTTTCCGAAACACAAATCACATGAAGCAGCGCACATTCCTCTCGATCGGGTCC
TGGGTTGCGATCAGTCTTGTGTTATGGGTGATAGCCTGGATTATTTCAGAGGCAATTCCTGTTTTCAATACTTTG
CTGAGTCTGATCGTAAGTAGTCGGGGATTGCATGTGACACCTACTGACATGGATTCATTTATTAGACTTCCCTTT
TTGCTAGCTGGTTTACCTGTGAGTGATATTCGGTACACAAACTGTTGATAATGCTAACCTAGATTAAAGATGGTC
TGAGTGGTATATTCTGGCTGTTCCTGAATCGAGGCCAGTATGGGGCGTCCTGGAAAAAAATGGTTCTGACTGTTG
TCAACCTGGTGGTTATCGGGATTGGTGCTTGCTTGGTATGTCAAATTTCACAATGCTCAGACATTTTTCAGACTA
CTAATATTCATGAAGTGCGGCATGGGCCTTTGGGTTTCCGGTAAGGCAATGCACGATGATTCCAGTGGTGCCAGC
TTTTCATGTGCTGCCAGAAGTGGATGAACCCTGATGTCCTGATGTTCATGAATGTCTGCAATTTTTTACAGGTAT
AATTTGGCTTTCTTTTTAGTGAATTTGAATCATTAATATCAAGATCAGTGTTATTCTCGGCCTGCGTGTTACTTA
CATTTAAATCATGTGTTGTTCGTGTATTCGAATGATATATATCCACCTCCAAACATCCATTTTCCGAACAAAGGA
CTGACGCAATATTGAACCGCCTGAATATGTACTGAGCTTGTCGAACTTCCATTCGAAAATACGCAACGATGTCGT
TACCTACCTACATCATGCATGACTCAGCCTAGCGTCGATGGATGGATGGGTGCCATGACGTTTTGCAAGATCAAA
AATCATCTGTTGTTTTAGAATGTAAAAAAAAGACACAGATGAGTTCGAATGATCGATTTCTACGAAACTGGTGTG
CTTGCATATATGAACGGGCTCATAGTGAGCTTCTACCCAGTGCTCACCCTGGTTGCTAATATCAGCAACGAACCA
CTGCCCTCAATTATCATCCTCCGTTGAATACGCGAGTCAGATTATTTGTGATGCCCAGCAAGGAAACCCAAACCT
TACTGTCCTCGCACAGCAATCAATCAGAGCGTGAATCAACTAGCTTGCAGACCGTGTTCGACGATGGCGACACAT
ACGACGTGGCCGATGGGTTGGAAAGCAATGGGGGCTCTTCGAAAATCAAGCCCGAGAGATCTCCAAATGAGAAAG
ACAACCTGATAGTGGACTGGAACGGCACAAATGATCCAGCATGTTGTCCGATTCCCCTCCGAGTATACAAGGTTC
CTCTAATACAATTTTAGGAGAAGCCCAAGAACTTCCCCACGTGGAGGAAGTGGGTGATCACTATGGTGCTAGGAA
TGATGACACTCTGCGTTACTTTTGGCTCTTCGATCTTCACAACAGCAACGAGACAGACAGCGACAAAGTTCGGCG
TCTCCATGGAAGTCACGTTGTTGGCTGTCAGTTTGTTCGTTCTGGGCTTCGCCTTTGGCCCTATCATCTTTGGCC
CCCTTTCTGAACTGTACGGCCGGAAGCTACCGTTGTTTCTGGGCATGTTCGGCTTCGCAATCTTCCAGATTCCCG
TAGCCGTAGCCGAGAACTTGCACACTATCTTCATATGTCGCTTTCTGGGCGGAACCTTTGCCAGTGCACCTCTTG
CCATTGTGAGTTTATTTCATTATTTCCAAGCTGCGCATTTACTTTCGCTCACTGACTTCCTCCTCCTTAGGTAAA
TGGCATTTTGGCCGATATGTTCGAGCCCGTGGAGCGAGGGATTGCAATGGCCGTCTTCGCTGCGGCAGCCTTCAT
CGGCCCGGTAGCAGGGCCAATCGTCGGTGGATTCATAACAATTTCATACCTGGGCTGGCGCTGGACAGAGTACAT
TACAGCTATCTGGGCATTTGCTATCTCCAGCATCGGGATCCTGGTTGTCCCCGAGACGTTCGAGCAAACTTTACT
CACACAACGCGCTAAGCGACTTCGCACCAAATCCAAGAACTGGGCTCTTCATGCGAAGGCAGAAGAAAAGGTAGT
CAGTTATCAAGATATTGCAGTACAATATCTCCTGCGCCCGTTCCAGATGCTTGTGCAGGAACCCATTCTTCTGCT
TATTACCTTGTACATGGGTTTCATATATGGCTTTCTGTACACTTGTTTTGTGGCCTATCCGGTCTCCTTCCAAGA
ACAGCGTGGGTGGAATGATGGCATTGGAGCGTTGCCGTTCGTTGCTTTCATTTGTGGTGTCTTTTGCGGTTGTTT
GATTATCATTGCATTTTCATTGACGCGGTATCGAACGTTCATACTCCGCAATGGCCGAGTTCAGCCAGAGGAGCG
GTTGATTCCTATGATTATTGGAGGTATTTTGTTGCCCGTGGGGATGTTTTGGTTTGGCTGGACGTCAGATCCTCA
CATAATTTGGGTTCCACAAGTTATATCTGGGGCATTCTTGGGGTCGGGGGTATTATTGATCTTCCTGCAGGTATT
ATTATCCCTATTGGAAGATGAATAACATTTTACAAATACTTACGATACTCGCCAGGGGCTGACTTATATCGTCGA
TGTGTATCCGATGTATACAAACTCTGCAATGGCAGCAAACTCCTTCTTTCGGTCATGGCTGGGGGCTGGATTTCC
GATGTTCGCACCACCATTGGTATGTCATGTCCCTCTATTAGCGGCGCAATTCGGCTAACCGCAATACAACATGTA
GTTTCATAACTTGGGCGTCGACTGGGCGATGACTTTGCTAGGTTGTCTGACCGTCGCGTTGTTCCCTGTGCCCAT
TGCGTTTTTCATATATGGGCCGAAAATACGCTCATGGAGTAGGTTTACCATGAAGGAAGAATGAAGGTAGAGCTG
TGAGATATTCAGGGCCGATCGAGCGGAGTTTCATCGGACATAGGTCTTATATCGTGATATCTGTGACTGGTCAAT
ATAGGATGTTGATATAGACTGACATAATATTATCAAGTGAACATCGCAACATCTTAGTATTCGCAGCTCTAGACC
GGAGGAGTTATCAGGCCCTTTGTCGTTATTATGCAATTTGTATGACCAAAGTTAACGAGCCGTTACTCCGAACAT
CCGTCTCGGCTAGAAGTTGCAACAAAAACGACAAATATGTATGACAAGCAGTTAGTGTTATCGCGGCCCGAGGCA
TAAATAGTCGCTAAAATCTCCATCGGCCATGTCCGATGTGGAGAAAACTGTCGCATACGAAAGAGCGACCTTGAT
GCTACACGGTCGAGCCAATCCGGTAGTGGAAACCTTACCCCAGCTTTTCACCAGCGCCGCAGAGTTTCAGCTAAG
CTCAATGGCGCAACCCATGCAGCTTGAATCGTCCATCACCACATCTCGTGAGGGGGAACCTGGGGAAACCAAGAC
TTTTAGCTAATATTATCCTCCCGCTTCATGGCTCTCGAGCATTTCTACTCCACTCTTCTCGAAGACTTGGTCTTC
GGTTCCACACTCTCGCCAATGGGAGCTGCGCTTCATCGATCCGGTCTGCGCCGCCCCACGCACTGCTCGGTTCCA
CCAATATCACGATCGTCCGGTGGGCGGCGTTCGCCGTCCAGTACTCAGATGAGTGTATATATGATCTTTATATCC
AACCTCGTATCGATTTGGCGGGGAAATCGGTGTGGCTTGACCTCCAAACCCTAGATCTTCAATTCGTCTCTATCC
GATACCAATATTGCACCATGGCGCCATATTTTGGCCTCCGTGGCCCTTCGCTGAATAGGGCTATCATGTGGTTGG
TCGTGTGTCCGGCCTTCGTGACTTATGGATACAACCAAGGTGTGATGGGAGGTCTGTTGACCCTGGAATCCTTCG
CCGAGACCTTTCCGCAGATGAACACTCTCACTGCAACCGCCGCACAAGAGAAGTATAACTCGACTATTCAAGGTA
AGCTTCATCACTATACCTGGGGCACAGATCGGTCCCAGGCCCTTGGCACACCACTTGGCCCGTTTCTCATGCTGT
ATACTTGCAGGCACGGTAGTCGCACTATATACCGTTGGTGGAATTTTTGGTTCACTATCATGCATTCAATTCGGT
GACAGGCTCGGCCGCCGGAAGGTCATCCTGTTCACCTCCTTCATTTCGATAATTGGCGCTGTCTTGATGGCAACG
TCCTTTTCACTTGCACAATTTATCGTTGCACGACTCGTCCTCGGATATGGAACTGGCGGTTACGTGGCTACAGTA
CCCGTCTGGCAGTCCGAGATCTCAAAGCCCAGCAAGCGTGGTGCTCACGTAGTAACTGACGGCATCTTCATCGGT
GCCGGTATCGCCTTCTCTCTCTGGGTCGACTTCGGCTTTTACTTCGTTAAGACCAACTCGGTTTCCTGGCGATTC
CCCTTGGTCTTCCAGGTCCTGCTATCACTAATGGTCATGAGCTTTGTGATGCTCTTCCCCGAATCGCCCCGATGG
CTGATCAAAAGAGGTCGCAGCGAGGAGGCGCGCGAGATTTTGGCGGCGCTGGACGACGTCGACCCTCATTCGGAA
CAGATCACTCTCGATATTCGCGATATTGAGACCTCCCTAGCTATTTCCGGAACCGGTTCGTGGAAGGATATGCTG
AAGATGGGCGAGCAGCGACTCTTCCATCGCACCGTTCTCGCCTGTATGGGTCAAATGTTTCAGCAGATGTGCGGA
ATCAATCTAATCACTTTCTACGCCACGACCATTTTCGAACAATATCTCAAGCTCTCTCCCATCCAGTCGCGTGTC
CTGGCCGCATCCATGTGCCTAACACAGCCGCTGGGCGGCCTGCTGGCCTATTTTACCATCGACCGTCTCGGTCGC
CGCGTGCTCATGCTGTGGAGTGCTGTCGGGATGTCAATCTCTATGGCCATCCTGGCTGGCACCACTTCCGTCCAA
GATAACACCGGCAGCTTGGTCTGCGCCGTCGTGTTCCTTTTCGTCTTCGAATTCATCTTCACAGTCGGATACTCC
GGCTTGACCTTCCTGTACGCCACAGAGGTCGCTCCCCTCCAGTGTCGAGCATCTATCAGCGCCGTCTCCGCGGCC
GCCGTCTGGACTTTTAACTTCCTCCTCGCTGAGGTCACGCCCGTCGGCTTCGCTACCATCGACTACCAGTACTAT
ATTATCTTCGCTGTGCTGAACGCCGCCATCGTGCCGACTGTGTATTTCTTCTTCCCGGAGACTAGCGGCCGCAGC
CTCGAGGAAATCGATGAGATCTTCTTGCAGTCGCGCAGTATATTCGATCCGCCTCGCATTGCTCGCTCGCTTCCC
CGAATGCACGTTGCCGATCCTCATGGGTTGGATCTCGACGCCAAGGATGTTGGAAGCGGTGATGAGGCCACGGGC
GAGAAGCCCAAAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail