Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8703.t1
Gene name
Locationscaffold_36:72693..74495
Strand-
Gene length (bp)1802
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 2.0E-50 35 480
PF00324 AA_permease Amino acid permease 3.1E-23 54 490

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 66 88 22
3 122 144 22
4 164 183 19
5 190 212 22
6 227 249 22
7 270 292 22
8 315 337 22
9 370 392 22
10 396 418 22
11 439 461 22
12 471 493 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8703.t1
MEEHPTKDLPEMEGSPQDQDDMTRMGKIQELKRNFRPLAALSFSAVLQATWEFILISNTQGLENGGLAGVFWSYM
WTFVGFGFIIVSLAEMASMAPTSGGQYHWVSEFSSPRYQKFLSYTTGWMSVLAWQAGAASGSFLTGTIIQGLITL
RDPSYVPQNWHGTLFVFAMIAVIYFFNVYAASWMPRIQNILLVLHLLCWVIIVVVLFTMAPQNSAKTVFTSFHNG
GNWSSMGISLMIGQITAIYGSLSSDATAHMSEEVKDAGRYVPIAIVWGYFGNGILALIVIVGFLLAIPSVPDAIN
DSTGFPFLYVFHQFLSISGVNGLTSIILIPVIFSNILFNASTARQTYAFARDRGLPFADWLSRVDLHRRIPVRAI
ALSCMISVLLSVINIGSEVAFNAIISLNVAALMYTYAVSISCVIYRKIACPETLPPRRWSLGRFGLAINIIGLLY
VIFALFWSFWPPSPLPSARDFNWSVVIFVSVFIGSLLMYLFQGRRHYVGPAMTVQRSY*
Coding >Pro_DTO377G3_2|g8703.t1
ATGGAAGAACATCCCACGAAAGATTTACCAGAGATGGAGGGCAGTCCACAGGATCAGGATGATATGACGCGTATG
GGGAAGATCCAGGAATTGAAGCGCAACTTTCGACCCCTTGCAGCGTTGAGCTTTTCAGCGGTTCTTCAAGCTACC
TGGGAGTTTATACTCATCTCAAACACCCAAGGTCTCGAAAATGGCGGACTGGCTGGTGTATTCTGGTCTTACATG
TGGACATTCGTTGGGTTTGGCTTTATCATTGTTTCGCTAGCCGAGATGGCTTCGATGGCACCCACATCGGGAGGC
CAATATCATTGGGTATCAGAGTTTTCCTCGCCTCGTTACCAGAAGTTTCTGAGTTACACCACTGGATGGATGTCC
GTACTAGCCTGGCAGGCAGGAGCAGCATCCGGCTCGTTTCTAACTGGAACTATCATCCAAGGTCTCATAACCCTC
CGTGATCCGAGCTACGTGCCCCAAAATTGGCATGGAACCTTGTTTGTGTTCGCCATGATAGCTGTCATTTACTTT
TTCAATGTCTACGCGGCAAGCTGGATGCCACGAATCCAGAACATCCTTCTCGTGCTACATCTGTTATGCTGGGTC
ATCATTGTGGTTGTTTTGTTCACCATGGCTCCTCAAAACTCGGCCAAAACCGTGTTCACATCGTTCCACAATGGT
GGCAACTGGTCTAGTATGGGGATCAGCTTGATGATCGGTCAAATTACAGCCATCTACGGCTCTCTGAGCTCCGAC
GCCACCGCACATATGTCCGAAGAAGTTAAGGATGCAGGTCGATACGTACCAATCGCAATCGTATGGGGATACTTC
GGCAACGGAATACTAGCACTGATAGTAATCGTTGGATTTCTTCTTGCTATCCCCTCAGTACCCGATGCTATCAAC
GACAGCACCGGCTTCCCCTTCCTCTACGTGTTCCACCAATTCCTCTCAATCTCCGGTGTCAACGGCCTCACATCA
ATAATCCTAATACCAGTCATCTTCAGTAACATCCTATTCAATGCATCAACTGCACGTCAAACATATGCATTCGCA
CGAGATCGCGGCCTCCCCTTCGCAGACTGGCTCTCTCGAGTTGACCTTCATCGGCGAATCCCAGTGCGAGCGATC
GCGCTCTCATGCATGATCAGTGTCTTACTGTCGGTAATCAACATAGGCTCGGAGGTTGCATTCAACGCGATCATC
TCTCTCAACGTTGCTGCACTGATGTACACATACGCGGTATCCATAAGTTGCGTGATTTACCGGAAGATTGCTTGT
CCTGAAACGCTACCTCCTCGACGTTGGAGTCTTGGTCGTTTCGGTCTTGCGATAAATATCATTGGGCTGCTCTAT
GTTATTTTCGCACTCTTTTGGTCGTTCTGGCCTCCGAGCCCTTTGCCTTCGGCTCGAGACTTTAATTGGAGTGTG
GTTATTTTCGTTAGTGTGTTCATCGGCAGTCTTTTGATGTACCTGTTTCAGGGCAGAAGACACTATGTCGGGCCT
GCGATGACGGTCCAGCGGAGCTATTGA
Transcript >Pro_DTO377G3_2|g8703.t1
ATGGAAGAACATCCCACGAAAGATTTACCAGAGATGGAGGGCAGTCCACAGGATCAGGATGATATGACGCGTATG
GGGAAGATCCAGGAATTGAAGCGCAACTTTCGACCCCTTGCAGCGTTGAGCTTTTCAGCGGTTCTTCAAGCTACC
TGGGAGTTTATACTCATCTCAAACACCCAAGGTCTCGAAAATGGCGGACTGGCTGGTGTATTCTGGTCTTACATG
TGGACATTCGTTGGGTTTGGCTTTATCATTGTTTCGCTAGCCGAGATGGCTTCGATGGCACCCACATCGGGAGGC
CAATATCATTGGGTATCAGAGTTTTCCTCGCCTCGTTACCAGAAGTTTCTGAGTTACACCACTGGATGGATGTCC
GTACTAGCCTGGCAGGCAGGAGCAGCATCCGGCTCGTTTCTAACTGGAACTATCATCCAAGGTCTCATAACCCTC
CGTGATCCGAGCTACGTGCCCCAAAATTGGCATGGAACCTTGTTTGTGTTCGCCATGATAGCTGTCATTTACTTT
TTCAATGTCTACGCGGCAAGCTGGATGCCACGAATCCAGAACATCCTTCTCGTGCTACATCTGTTATGCTGGGTC
ATCATTGTGGTTGTTTTGTTCACCATGGCTCCTCAAAACTCGGCCAAAACCGTGTTCACATCGTTCCACAATGGT
GGCAACTGGTCTAGTATGGGGATCAGCTTGATGATCGGTCAAATTACAGCCATCTACGGCTCTCTGAGCTCCGAC
GCCACCGCACATATGTCCGAAGAAGTTAAGGATGCAGGTCGATACGTACCAATCGCAATCGTATGGGGATACTTC
GGCAACGGAATACTAGCACTGATAGTAATCGTTGGATTTCTTCTTGCTATCCCCTCAGTACCCGATGCTATCAAC
GACAGCACCGGCTTCCCCTTCCTCTACGTGTTCCACCAATTCCTCTCAATCTCCGGTGTCAACGGCCTCACATCA
ATAATCCTAATACCAGTCATCTTCAGTAACATCCTATTCAATGCATCAACTGCACGTCAAACATATGCATTCGCA
CGAGATCGCGGCCTCCCCTTCGCAGACTGGCTCTCTCGAGTTGACCTTCATCGGCGAATCCCAGTGCGAGCGATC
GCGCTCTCATGCATGATCAGTGTCTTACTGTCGGTAATCAACATAGGCTCGGAGGTTGCATTCAACGCGATCATC
TCTCTCAACGTTGCTGCACTGATGTACACATACGCGGTATCCATAAGTTGCGTGATTTACCGGAAGATTGCTTGT
CCTGAAACGCTACCTCCTCGACGTTGGAGTCTTGGTCGTTTCGGTCTTGCGATAAATATCATTGGGCTGCTCTAT
GTTATTTTCGCACTCTTTTGGTCGTTCTGGCCTCCGAGCCCTTTGCCTTCGGCTCGAGACTTTAATTGGAGTGTG
GTTATTTTCGTTAGTGTGTTCATCGGCAGTCTTTTGATGTACCTGTTTCAGGGCAGAAGACACTATGTCGGGCCT
GCGATGACGGTCCAGCGGAGCTATTGA
Gene >Pro_DTO377G3_2|g8703.t1
ATGGAAGAACATCCCACGAAAGATTTACCAGAGATGGAGGGCAGTCCACAGGATCAGGATGATATGACGCGTATG
GGGAAGATCCAGGAATTGAAGGTCTTCTTTCTTTCTCTGTGACACAATCAGGACACTGTTACTGACATGTTTGAA
GCGCAACTTTCGACCCCTTGCAGCGTTGAGCTTTTCAGCGGTTCTTCAAGCTACCTGGGAGTTTATACTCATGTG
AGCCGCAGTCTCTTGGGCCATCTTATCAGCTGCTAATCGCCTCATCCTTAGCTCAAACACCCAAGGTCTCGAAAA
TGGCGGACTGGCTGGTGTATTCTGGTCTTACATGTGGACATTCGTTGGGTTTGGCTTTATCATTGTTTCGCTAGC
CGAGATGGCTTCGATGTGAGTTATTATGTGCCTCATTTTCTGAGATTTCTCACTTTTCCTTTCTCCAACAGGGCA
CCCACATCGGGAGGCCAATATCATTGGGTATCAGAGTTTTCCTCGCCTCGTTACCAGAAGTTTCTGAGTTACACC
ACTGGTGAGATCGCTCGTCTATTCATCTTTGACGATTGCTAATGGGTGTGATTAAGGATGGATGTCCGTACTAGC
CTGGCAGGCAGGAGCAGCATCCGGCTCGTTTCTAACTGGAACTATCATCCAAGGTCTCATAACCCTCCGTGATCC
GAGCTACGTGCCCCAAAATTGGCATGGAACCTTGTTTGTGTTCGCCATGATAGCTGTCATTTACTTTTTCAATGT
CTACGCGGCAAGCTGGATGCCACGAATCCAGAACATCCTTCTCGTGCTACATCTGTTATGCTGGGTCATCATTGT
GGTTGTTTTGTTCACCATGGCTCCTCAAAACTCGGCCAAAACCGTGTTCACATCGTTCCACAATGGTGGCAACTG
GTCTAGTATGGGGATCAGCTTGATGATCGGTCAAATTACAGCCATCTACGGCTCTCTGAGTGTGTACAAACCGTA
TCATTCTTTCGCGGTACAAGGCTAACATGGACACATTTATAGGCTCCGACGCCACCGCACATATGTCCGAAGAAG
TTAAGGATGCAGGTCGATACGTACCAATCGCAATCGTATGGGGATACTTCGGCAACGGAATACTAGCACTGATAG
TAATCGTTGGATTTCTTCTTGCTATCCCCTCAGTACCCGATGCTATCAACGACAGCACCGGCTTCCCCTTCCTCT
ACGTGTTCCACCAATTCCTCTCAATCTCCGGTGTCAACGGCCTCACATCAATAATCCTAATACCAGTCATCTTCA
GTAACATCCTATTCAATGCATCAACTGCACGTCAAACATATGCATTCGCACGAGATCGCGGCCTCCCCTTCGCAG
ACTGGCTCTCTCGAGTTGACCTTCATCGGCGAATCCCAGTGCGAGCGATCGCGCTCTCATGCATGATCAGTGTCT
TACTGTCGGTAATCAACATAGGCTCGGAGGTTGCATTCAACGCGATCATCTCTCTCAACGTTGCTGCACTGATGT
ACACATACGCGGTATCCATAAGTTGCGTGATTTACCGGAAGATTGCTTGTCCTGAAACGCTACCTCCTCGACGTT
GGAGTCTTGGTCGTTTCGGTCTTGCGATAAATATCATTGGGCTGCTCTATGTTATTTTCGCACTCTTTTGGTCGT
TCTGGCCTCCGAGCCCTTTGCCTTCGGCTCGAGACTTTAATTGGAGTGTGGTTATTTTCGTTAGTGTGTTCATCG
GCAGTCTTTTGATGTACCTGTTTCAGGGCAGAAGACACTATGTCGGGCCTGCGATGACGGTCCAGCGGAGCTATT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail