Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g870.t1
Gene name
Locationscaffold_01:2319739..2321695
Strand-
Gene length (bp)1956
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.0E-64 18 365

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.58 1.58 7.58
5d_25C Five days - 25 degrees Celsius 11.65 5.30 18.00
7d_25C Seven days - 25 degrees Celsius 14.07 6.84 21.30
10d_25C Ten days - 25 degrees Celsius 20.04 10.58 29.51
7d_15C Seven days - 15 degrees Celsius 44.90 26.02 63.79
7d_30C Seven days - 30 degrees Celsius 11.88 5.49 18.28

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.001804 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.001804 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.600962 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.969259 no
5d_25C 10d_25C 0.051659 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.652491 no
7d_25C 10d_25C 0.227602 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.058634 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g870.t1
MNVLRLLLLTTLAVAKQPNILFILTDDQGKYVGGLEHMPKLQETLVQQGTSYSKHFCSIALCCPSRANLWTGRMP
HNTNVTDVGLPYGGYPKVVSAGWNDNYLPLWMQEAGYNTYYVGKMWNAHTEENYNNPYVRGFNGSDFLLDPYTYR
YWYARMTRNGAAPVKYDGQYSTDVIAEKAEGFIDEAVKHKQPWMLTVAPNAPHSNGSHDSTRNANWFGEPEFAPR
HAGLFEDVQAPRDESFNTLIENAVSWVQNVPELNQTNVDYIDEFQRCRLRALQAVDEMVGRLVERLEKVGELDNT
YIFFSTDNGYHLGQHRMQPGKNCGYETDINVPLIVRGPGIGKNQTLDAITSHTDLAPTFLNIAGVTRDGLDGKTI
PTTIAASTADNRTEHVAIEYWGLAVPEGIYGYASDKLDQPHNSYQRNTYKGIRLVADDYSLYYAVWCTNEKEFFD
LKSDPHQTVNLGTYPAKHPNYKIANRELPQIIARLDALMLVLKSCEGDACRYPWRQLHPAGKVNSLADALDSGFD
TFYANQPKVSFSSCENGYIISAEGPQTFNAYGASAKRGWSLDELFGW*
Coding >Pro_DTO377G3_2|g870.t1
ATGAACGTACTGAGATTGCTGCTCTTGACAACTCTAGCTGTCGCCAAGCAACCTAATATTCTCTTCATTCTAACA
GATGATCAGGGTAAATATGTGGGCGGTTTAGAGCACATGCCCAAGTTGCAGGAAACTCTCGTTCAACAAGGAACA
AGCTACTCCAAACATTTCTGCTCAATCGCACTATGCTGTCCATCCCGAGCCAACCTCTGGACCGGTCGCATGCCA
CACAACACGAACGTAACCGACGTTGGACTCCCCTACGGCGGCTATCCAAAAGTAGTCTCAGCAGGCTGGAACGAC
AACTACCTCCCACTATGGATGCAAGAAGCAGGCTACAACACCTACTACGTAGGCAAGATGTGGAATGCACACACA
GAGGAAAACTACAACAATCCGTACGTACGAGGGTTCAACGGCTCGGACTTCCTCCTAGATCCGTACACATACCGA
TACTGGTACGCACGGATGACGCGCAACGGCGCAGCACCAGTCAAGTACGACGGGCAGTACTCGACAGACGTGATC
GCCGAAAAAGCAGAGGGTTTCATCGACGAGGCGGTTAAGCACAAACAGCCGTGGATGCTGACAGTAGCGCCCAAC
GCGCCACACTCGAATGGGTCTCATGATTCCACGAGGAACGCGAACTGGTTCGGTGAGCCGGAGTTTGCGCCGCGG
CATGCGGGTTTGTTTGAGGATGTGCAGGCGCCGCGCGATGAGAGCTTTAATACACTGATTGAGAATGCCGTTAGC
TGGGTGCAGAATGTGCCTGAGTTGAATCAGACGAATGTTGATTATATTGATGAGTTCCAGCGGTGTCGGCTGCGG
GCTTTGCAGGCTGTTGATGAGATGGTTGGGAGGCTTGTTGAGAGGTTGGAAAAGGTTGGGGAGCTGGATAATACT
TATATCTTCTTTTCGACGGATAATGGGTATCATCTGGGCCAGCATCGGATGCAGCCTGGTAAGAACTGTGGTTAT
GAAACTGATATCAACGTCCCTCTCATCGTCCGAGGCCCTGGTATCGGAAAGAATCAGACTCTGGATGCTATCACT
TCTCATACGGATCTAGCTCCTACTTTCTTGAACATAGCTGGCGTTACTCGAGACGGATTGGACGGTAAGACTATC
CCTACTACCATTGCTGCCAGCACGGCAGACAATAGGACGGAGCATGTTGCTATTGAATACTGGGGATTAGCAGTA
CCAGAAGGGATCTACGGGTATGCCAGCGACAAACTCGACCAGCCACATAACAGCTACCAAAGAAACACATACAAG
GGTATCCGACTGGTTGCCGACGACTATAGTCTATACTATGCAGTATGGTGCACAAACGAGAAAGAGTTCTTCGAT
CTGAAGAGCGATCCCCATCAAACCGTGAACCTAGGCACATACCCAGCCAAACACCCCAACTACAAGATTGCAAAT
CGCGAGCTGCCACAAATAATAGCGCGATTGGACGCACTCATGCTAGTGCTCAAGTCCTGCGAAGGTGACGCATGT
CGATACCCCTGGCGCCAGCTACACCCAGCCGGTAAAGTGAACAGTCTTGCTGATGCGCTGGACTCGGGCTTCGAT
ACCTTCTACGCGAATCAGCCGAAGGTCTCGTTCTCGTCTTGTGAGAATGGGTATATTATTTCGGCTGAGGGGCCG
CAGACGTTCAATGCTTATGGGGCCAGTGCAAAGAGAGGATGGAGTTTGGATGAGTTGTTTGGGTGGTGA
Transcript >Pro_DTO377G3_2|g870.t1
ATGAACGTACTGAGATTGCTGCTCTTGACAACTCTAGCTGTCGCCAAGCAACCTAATATTCTCTTCATTCTAACA
GATGATCAGGGTAAATATGTGGGCGGTTTAGAGCACATGCCCAAGTTGCAGGAAACTCTCGTTCAACAAGGAACA
AGCTACTCCAAACATTTCTGCTCAATCGCACTATGCTGTCCATCCCGAGCCAACCTCTGGACCGGTCGCATGCCA
CACAACACGAACGTAACCGACGTTGGACTCCCCTACGGCGGCTATCCAAAAGTAGTCTCAGCAGGCTGGAACGAC
AACTACCTCCCACTATGGATGCAAGAAGCAGGCTACAACACCTACTACGTAGGCAAGATGTGGAATGCACACACA
GAGGAAAACTACAACAATCCGTACGTACGAGGGTTCAACGGCTCGGACTTCCTCCTAGATCCGTACACATACCGA
TACTGGTACGCACGGATGACGCGCAACGGCGCAGCACCAGTCAAGTACGACGGGCAGTACTCGACAGACGTGATC
GCCGAAAAAGCAGAGGGTTTCATCGACGAGGCGGTTAAGCACAAACAGCCGTGGATGCTGACAGTAGCGCCCAAC
GCGCCACACTCGAATGGGTCTCATGATTCCACGAGGAACGCGAACTGGTTCGGTGAGCCGGAGTTTGCGCCGCGG
CATGCGGGTTTGTTTGAGGATGTGCAGGCGCCGCGCGATGAGAGCTTTAATACACTGATTGAGAATGCCGTTAGC
TGGGTGCAGAATGTGCCTGAGTTGAATCAGACGAATGTTGATTATATTGATGAGTTCCAGCGGTGTCGGCTGCGG
GCTTTGCAGGCTGTTGATGAGATGGTTGGGAGGCTTGTTGAGAGGTTGGAAAAGGTTGGGGAGCTGGATAATACT
TATATCTTCTTTTCGACGGATAATGGGTATCATCTGGGCCAGCATCGGATGCAGCCTGGTAAGAACTGTGGTTAT
GAAACTGATATCAACGTCCCTCTCATCGTCCGAGGCCCTGGTATCGGAAAGAATCAGACTCTGGATGCTATCACT
TCTCATACGGATCTAGCTCCTACTTTCTTGAACATAGCTGGCGTTACTCGAGACGGATTGGACGGTAAGACTATC
CCTACTACCATTGCTGCCAGCACGGCAGACAATAGGACGGAGCATGTTGCTATTGAATACTGGGGATTAGCAGTA
CCAGAAGGGATCTACGGGTATGCCAGCGACAAACTCGACCAGCCACATAACAGCTACCAAAGAAACACATACAAG
GGTATCCGACTGGTTGCCGACGACTATAGTCTATACTATGCAGTATGGTGCACAAACGAGAAAGAGTTCTTCGAT
CTGAAGAGCGATCCCCATCAAACCGTGAACCTAGGCACATACCCAGCCAAACACCCCAACTACAAGATTGCAAAT
CGCGAGCTGCCACAAATAATAGCGCGATTGGACGCACTCATGCTAGTGCTCAAGTCCTGCGAAGGTGACGCATGT
CGATACCCCTGGCGCCAGCTACACCCAGCCGGTAAAGTGAACAGTCTTGCTGATGCGCTGGACTCGGGCTTCGAT
ACCTTCTACGCGAATCAGCCGAAGGTCTCGTTCTCGTCTTGTGAGAATGGGTATATTATTTCGGCTGAGGGGCCG
CAGACGTTCAATGCTTATGGGGCCAGTGCAAAGAGAGGATGGAGTTTGGATGAGTTGTTTGGGTGGTGA
Gene >Pro_DTO377G3_2|g870.t1
ATGAACGTACTGAGATTGCTGCTCTTGACAACTCTAGCTGTCGCCAAGCAACCTAATATTCTCTTCATTCTAACA
GATGATCAGGGTAAATATGTGGGCGGTTTAGAGCACATGCCCAAGTTGCAGGTGGGTCTATTCCTTCCATACAAG
CCCTACTTTCTCCCTCCCCAGACTAACACTTTAACAAGGAAACTCTCGTTCAACAAGGAACAAGCTACTCCAAAC
ATTTCTGCTCAATCGCACTATGCTGTCCATCCCGAGCCAACCTCTGGACCGGTCGCATGCCACACAACACGAACG
TAACCGACGTTGGACTCCCCTACGGCGGCTATCCAAAAGTAGTCTCAGCAGGCTGGAACGACAACTACCTCCCAC
TATGGATGCAAGAAGCAGGCTACAACACCTACTACGTAGGCAAGATGTGGAATGCACACACAGAGGAAAACTACA
ACAATCCGTACGTACGAGGGTTCAACGGCTCGGACTTCCTCCTAGATCCGTACACATACCGATACTGGTACGCAC
GGATGACGCGCAACGGCGCAGCACCAGTCAAGTACGACGGGCAGTACTCGACAGACGTGATCGCCGAAAAAGCAG
AGGGTTTCATCGACGAGGCGGTTAAGCACAAACAGCCGTGGATGCTGACAGTAGCGCCCAACGCGCCACACTCGA
ATGGGTCTCATGATTCCACGAGGAACGCGAACTGGTTCGGTGAGCCGGAGTTTGCGCCGCGGCATGCGGGTTTGT
TTGAGGATGTGCAGGCGCCGCGCGATGAGAGCTTTAATACACTGATTGAGAATGCCGTTAGCTGGGTGCAGAATG
TGCCTGAGTTGAATCAGACGAATGTTGATTATATTGATGAGTTCCAGCGGTGTCGGCTGCGGGCTTTGCAGGCTG
TTGATGAGATGGTTGGGAGGCTTGTTGAGAGGTTGGAAAAGGTTGGGGAGCTGGATAATACTTATATCTTCTTTT
CGACGGATAATGGGTATCATCTGGGCCAGCATCGGATGCAGCCTGGTAAGAACTGTGGTTATGGTGAGTTGGTCT
TGATTGTCTTGATTGTCTATGGTGTATAGATATGCTAACTCGTATAGAAACTGATATCAACGTCCCTCTCATCGT
CCGAGGCCCTGGTATCGGAAAGAATCAGACTCTGGATGCTATCACTTCTCATACGGATCTAGCTCCTACTTTCTT
GAACATAGCTGGCGTTACTCGAGACGGATTGGACGGTAAGACTATCCCTACTACCATTGCTGCCAGCACGGCAGA
CAATAGGACGGAGCATGTTGCTATTGAATACTGGGGATTAGTGAGTAATTCACACAGCAAGCACATATTAACCAA
CCAGCTAACATCAAGATAGGCAGTACCAGAAGGGATCTACGGGTATGCCAGCGACAAACTCGACCAGCCACATAA
CAGCTACCAAAGAAACACATACAAGGGTATCCGACTGGTTGCCGACGACTATAGTCTATACTATGCAGTATGGTG
CACAAACGAGAAAGAGTTCTTCGATCTGAAGGTAAGCCATCCATCCCCTTCTATCCCACAGGATATTCAACAAGC
CTTAACACTCTAAAAAAGAGCGATCCCCATCAAACCGTGAACCTAGGCACATACCCAGCCAAACACCCCAACTAC
AAGATTGCAAATCGCGAGCTGCCACAAATAATAGCGCGATTGGACGCACTCATGCTAGTGCTCAAGTCCTGCGAA
GGTGACGCATGTCGATACCCCTGGCGCCAGCTACACCCAGCCGGTAAAGTGAACAGTCTTGCTGATGCGCTGGAC
TCGGGCTTCGATACCTTCTACGCGAATCAGCCGAAGGTCTCGTTCTCGTCTTGTGAGAATGGGTATATTATTTCG
GCTGAGGGGCCGCAGACGTTCAATGCTTATGGGGCCAGTGCAAAGAGAGGATGGAGTTTGGATGAGTTGTTTGGG
TGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail