Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g869.t1
Gene name
Locationscaffold_01:2317387..2319523
Strand+
Gene length (bp)2136
Transcript length (bp)1917
Coding sequence length (bp)1917
Protein length (aa) 639

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00682 HMGL-like HMGL-like 2.9E-81 34 317
PF08502 LeuA_dimer LeuA allosteric (dimerisation) domain 8.9E-23 432 579

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003852 2-isopropylmalate synthase activity Yes
GO:0009098 leucine biosynthetic process Yes
GO:0046394 carboxylic acid biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:1901605 alpha-amino acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0016746 acyltransferase activity No
GO:0006551 leucine metabolic process No
GO:0044238 primary metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0003674 molecular_function No
GO:0046912 acyltransferase activity, acyl groups converted into alkyl on transfer No
GO:0006807 nitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009081 branched-chain amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009082 branched-chain amino acid biosynthetic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 99.89 60.93 138.85
5d_25C Five days - 25 degrees Celsius 91.22 55.52 126.92
7d_25C Seven days - 25 degrees Celsius 74.96 46.01 103.92
10d_25C Ten days - 25 degrees Celsius 75.46 46.32 104.61
7d_15C Seven days - 15 degrees Celsius 118.12 71.17 165.08
7d_30C Seven days - 30 degrees Celsius 91.51 56.11 126.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.758576 no
3d_25C 7d_25C 0.192905 no
3d_25C 7d_15C 0.520917 no
3d_25C 7d_30C 0.766408 no
3d_25C 10d_25C 0.209248 no
5d_25C 7d_25C 0.423731 no
5d_25C 7d_15C 0.275220 no
5d_25C 7d_30C 0.993328 no
5d_25C 10d_25C 0.444283 no
7d_25C 7d_15C 0.030646 yes
7d_25C 7d_30C 0.406173 no
7d_25C 10d_25C 0.985441 no
7d_15C 7d_30C 0.269978 no
7d_15C 10d_25C 0.028871 yes
7d_30C 10d_25C 0.428777 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g869.t1
MPMLKDPSKKYKPFKPVNLPNRQWPNKIIDKPPRWLATDLRDGNQSLPDPMDGEQKYRFFKMLVDIGYKEIEVSF
PSASQTDFDFTRRLVEEPGLTPDDVALQVLAPCREDLIRRTVDSLKGAKKAILHIYLATSPCFRRIIFNMDHKQS
LEMAVKCTKYARSITKDDPSQAGTDWQFEFSPETFSDTEPEYAVEVCQAVKAAWGPTEEKPIIFNLPATVEMATP
NVFADQVEYFCTNMTEREKFVVSVHPHNDRGCAVAAAELAQMAGADRVEGTLFGNGERTGNVDLVTLALNLYTQG
VSPNVDFSDINSVIKVVEESNKIPVNERAPYGGQLVVCAFSGSHQDAIKKGFKLRQDGEGADEETEWEVPYLPLD
PQDIGRTYEAVIRVNSQSGKGGAAWIILRSLELDLPRALQVEFSKIVQEKTEAVSRELKPTEIVNLFEEAYHLKS
NPRFTLVDYSITTDRSQSPAPPEPGKALNTKNLKRRFTGIIEIDNVQHAITGVGPGAISSLATALSTLGIDLDVR
DYKEHSIGRGRDTKAATYIQCTAAGSNQQVWGVGIHQDVVQASLIALLSAASSFLTSRAGSPAPFRPIRSNTLTN
EDIEALEQLTSTPEAVTSNGGLSAKANIEQLTKKAENL*
Coding >Pro_DTO377G3_2|g869.t1
ATGCCGATGCTCAAGGATCCCTCAAAAAAGTACAAGCCCTTCAAGCCGGTGAATCTGCCAAATCGCCAATGGCCC
AATAAAATTATTGACAAGCCTCCTCGCTGGCTGGCAACTGATCTGCGTGATGGCAACCAGTCTCTGCCGGACCCA
ATGGATGGCGAGCAAAAATACCGTTTCTTCAAGATGCTCGTGGATATTGGTTACAAGGAAATCGAAGTGTCCTTC
CCTTCCGCATCCCAAACGGACTTCGACTTTACCCGCCGTCTGGTAGAAGAGCCCGGTCTCACACCCGATGATGTC
GCCCTGCAGGTCCTGGCCCCCTGCCGTGAGGATCTCATCCGTCGCACAGTCGACTCCCTGAAGGGCGCCAAGAAG
GCTATCCTCCACATCTACCTCGCAACGAGCCCCTGTTTCCGTCGCATAATCTTCAACATGGACCACAAGCAGAGT
CTGGAGATGGCTGTCAAATGCACAAAGTATGCCCGCTCTATCACCAAGGACGACCCCTCCCAGGCCGGCACAGAT
TGGCAATTCGAGTTCTCCCCCGAGACTTTCTCCGATACCGAGCCCGAGTACGCCGTGGAGGTCTGCCAGGCTGTG
AAGGCTGCCTGGGGACCCACGGAGGAGAAGCCCATCATATTTAACCTGCCCGCCACGGTAGAGATGGCCACCCCC
AACGTCTTTGCTGATCAGGTCGAGTACTTCTGCACAAACATGACTGAGCGCGAGAAGTTTGTTGTCTCAGTCCAC
CCGCATAACGACCGTGGCTGCGCTGTTGCCGCCGCTGAACTGGCACAGATGGCTGGTGCCGATCGTGTAGAGGGT
ACTCTGTTCGGCAACGGTGAGCGTACCGGAAACGTGGACCTGGTTACTCTCGCCCTGAACCTGTACACACAAGGT
GTCTCGCCAAACGTCGACTTCTCGGACATCAACTCTGTCATCAAGGTGGTAGAGGAGAGCAACAAGATCCCAGTC
AACGAGCGTGCACCATATGGTGGTCAGCTCGTGGTGTGCGCATTCTCTGGAAGTCACCAAGATGCAATCAAGAAG
GGCTTCAAACTGCGCCAAGATGGCGAGGGCGCCGACGAGGAAACCGAGTGGGAAGTCCCGTACCTCCCCCTGGAT
CCCCAAGATATCGGCCGTACCTACGAGGCAGTCATCCGTGTCAACTCCCAAAGTGGCAAGGGTGGCGCCGCCTGG
ATTATCCTGCGAAGCCTGGAGCTGGATCTCCCTCGCGCTCTGCAGGTCGAGTTCAGCAAGATCGTGCAGGAGAAG
ACCGAGGCTGTCAGCCGGGAGCTGAAACCTACCGAGATCGTCAACCTCTTCGAGGAGGCCTACCACCTCAAGTCA
AACCCCCGCTTCACCCTTGTCGACTACAGCATCACCACCGACCGCTCGCAGTCCCCTGCTCCTCCTGAGCCCGGC
AAGGCCCTCAACACCAAGAACCTCAAGCGTCGCTTCACCGGTATTATCGAGATCGACAATGTTCAGCATGCCATC
ACCGGTGTCGGCCCAGGTGCTATTTCCTCCCTGGCTACCGCTCTTTCTACCCTCGGTATTGATCTCGATGTCCGC
GACTACAAGGAACACTCCATTGGTCGCGGTCGCGACACCAAGGCTGCTACCTACATTCAGTGCACAGCAGCCGGC
AGCAATCAACAGGTGTGGGGTGTTGGTATCCACCAGGATGTGGTCCAGGCCTCTCTGATTGCGCTGCTTAGCGCC
GCCAGCTCGTTCCTCACCTCCCGGGCTGGTTCTCCTGCTCCTTTCCGTCCCATCCGCTCCAACACCCTCACCAAC
GAGGACATCGAAGCTCTCGAGCAGTTGACCAGCACTCCAGAGGCTGTTACATCTAACGGCGGTCTGAGCGCCAAG
GCCAACATCGAACAGCTGACAAAAAAGGCTGAAAATTTGTAA
Transcript >Pro_DTO377G3_2|g869.t1
ATGCCGATGCTCAAGGATCCCTCAAAAAAGTACAAGCCCTTCAAGCCGGTGAATCTGCCAAATCGCCAATGGCCC
AATAAAATTATTGACAAGCCTCCTCGCTGGCTGGCAACTGATCTGCGTGATGGCAACCAGTCTCTGCCGGACCCA
ATGGATGGCGAGCAAAAATACCGTTTCTTCAAGATGCTCGTGGATATTGGTTACAAGGAAATCGAAGTGTCCTTC
CCTTCCGCATCCCAAACGGACTTCGACTTTACCCGCCGTCTGGTAGAAGAGCCCGGTCTCACACCCGATGATGTC
GCCCTGCAGGTCCTGGCCCCCTGCCGTGAGGATCTCATCCGTCGCACAGTCGACTCCCTGAAGGGCGCCAAGAAG
GCTATCCTCCACATCTACCTCGCAACGAGCCCCTGTTTCCGTCGCATAATCTTCAACATGGACCACAAGCAGAGT
CTGGAGATGGCTGTCAAATGCACAAAGTATGCCCGCTCTATCACCAAGGACGACCCCTCCCAGGCCGGCACAGAT
TGGCAATTCGAGTTCTCCCCCGAGACTTTCTCCGATACCGAGCCCGAGTACGCCGTGGAGGTCTGCCAGGCTGTG
AAGGCTGCCTGGGGACCCACGGAGGAGAAGCCCATCATATTTAACCTGCCCGCCACGGTAGAGATGGCCACCCCC
AACGTCTTTGCTGATCAGGTCGAGTACTTCTGCACAAACATGACTGAGCGCGAGAAGTTTGTTGTCTCAGTCCAC
CCGCATAACGACCGTGGCTGCGCTGTTGCCGCCGCTGAACTGGCACAGATGGCTGGTGCCGATCGTGTAGAGGGT
ACTCTGTTCGGCAACGGTGAGCGTACCGGAAACGTGGACCTGGTTACTCTCGCCCTGAACCTGTACACACAAGGT
GTCTCGCCAAACGTCGACTTCTCGGACATCAACTCTGTCATCAAGGTGGTAGAGGAGAGCAACAAGATCCCAGTC
AACGAGCGTGCACCATATGGTGGTCAGCTCGTGGTGTGCGCATTCTCTGGAAGTCACCAAGATGCAATCAAGAAG
GGCTTCAAACTGCGCCAAGATGGCGAGGGCGCCGACGAGGAAACCGAGTGGGAAGTCCCGTACCTCCCCCTGGAT
CCCCAAGATATCGGCCGTACCTACGAGGCAGTCATCCGTGTCAACTCCCAAAGTGGCAAGGGTGGCGCCGCCTGG
ATTATCCTGCGAAGCCTGGAGCTGGATCTCCCTCGCGCTCTGCAGGTCGAGTTCAGCAAGATCGTGCAGGAGAAG
ACCGAGGCTGTCAGCCGGGAGCTGAAACCTACCGAGATCGTCAACCTCTTCGAGGAGGCCTACCACCTCAAGTCA
AACCCCCGCTTCACCCTTGTCGACTACAGCATCACCACCGACCGCTCGCAGTCCCCTGCTCCTCCTGAGCCCGGC
AAGGCCCTCAACACCAAGAACCTCAAGCGTCGCTTCACCGGTATTATCGAGATCGACAATGTTCAGCATGCCATC
ACCGGTGTCGGCCCAGGTGCTATTTCCTCCCTGGCTACCGCTCTTTCTACCCTCGGTATTGATCTCGATGTCCGC
GACTACAAGGAACACTCCATTGGTCGCGGTCGCGACACCAAGGCTGCTACCTACATTCAGTGCACAGCAGCCGGC
AGCAATCAACAGGTGTGGGGTGTTGGTATCCACCAGGATGTGGTCCAGGCCTCTCTGATTGCGCTGCTTAGCGCC
GCCAGCTCGTTCCTCACCTCCCGGGCTGGTTCTCCTGCTCCTTTCCGTCCCATCCGCTCCAACACCCTCACCAAC
GAGGACATCGAAGCTCTCGAGCAGTTGACCAGCACTCCAGAGGCTGTTACATCTAACGGCGGTCTGAGCGCCAAG
GCCAACATCGAACAGCTGACAAAAAAGGCTGAAAATTTGTAA
Gene >Pro_DTO377G3_2|g869.t1
ATGCCGATGTATGTTGCGATGACTCCAATTCGGTGTTCCTACATACTAATCTCTTGAAGGCTCAAGGATCCCTCA
AAAAAGTACAAGCCCTTCAAGCCGGTGAATCTGCCAAATCGCCAATGGCCCAATAAAATTATTGACAAGCCTCCT
CGCTGGCTGGCAACTGATCTGCGTGATGGCAACCAGTCTCTGCCGGACCCAATGGTATGATATGATGTACTGCGC
TCAATGCTGTTTCCCATATTGATTGGATTGGATCTATAGGATGGCGAGCAAAAATACCGTTTCTTCAAGATGCTC
GTGGATATTGGTTACAAGGAAATCGAAGTGTCCTTCCCTTCCGCATCCCAAACGGACTTCGACTTTACCCGCCGT
CTGGTAGAAGAGCCCGGTCTCACACCCGATGATGTCGCCCTGCAGGTCCTGGCCCCCTGCCGTGAGGATCTCATC
CGTCGCACAGTCGACTCCCTGAAGGGCGCCAAGAAGGCTATCCTCCACATCTACCTCGCAACGAGCCCCTGTTTC
CGTCGCATAATCTTCAACATGGACCACAAGCAGAGTCTGGAGATGGCTGTCAAATGCACAAAGTATGCCCGCTCT
ATCACCAAGGACGACCCCTCCCAGGCCGGCACAGATTGGCAATTCGAGTTCTCCCCCGAGACTTTCTCCGATACC
GAGCCCGAGTACGCCGTGGAGGTCTGCCAGGCTGTGAAGGCTGCCTGGGGACCCACGGAGGAGAAGCCCATCATA
TTTAACCTGCCCGCCACGGTAGAGATGGCCACCCCCAACGTCTTTGCTGATCAGGTCGAGTACTTCTGCACAAAC
ATGACTGAGCGCGAGAAGTTTGTTGTCTCAGTCCACCCGCATAACGACCGTGGCTGCGCTGTTGCCGCCGCTGAA
CTGGCACAGATGGCTGGTGCCGATCGTGTAGAGGGTACTCTGTTCGGCAACGGTGAGCGTACCGGAAACGTGGAC
CTGGTTACTCTCGCCCTGAACCTGTACACACAAGGTGTCTCGCCAAACGTCGACTTCTCGGACATCAACTCTGTC
ATCAAGGTGGTAGAGGAGAGCAACAAGATCCCAGTCAACGAGCGTGCACCATATGGTGGTCAGCTCGTGGTGTGC
GCATTCTCTGGAAGGTTCGTTGTCCTTTCTTTTTCCTACGTTATTCGCTTTGCTAACCTATTTCGAATCCAGTCA
CCAAGATGCAATCAAGAAGGGCTTCAAACTGCGCCAAGATGGCGAGGGCGCCGACGAGGAAACCGAGTGGGAAGT
CCCGTACCTCCCCCTGGATCCCCAAGATATCGGCCGTACCTACGAGGCAGTCATCCGTGTCAACTCCCAAAGTGG
CAAGGGTGGCGCCGCCTGGATTATCCTGCGAAGCCTGGAGCTGGATCTCCCTCGCGCTCTGCAGGTCGAGTTCAG
CAAGATCGTGCAGGAGAAGACCGAGGCTGTCAGCCGGGAGCTGAAACCTACCGAGATCGTCAACCTCTTCGAGGA
GGCCTACCACCTCAAGTCAAACCCCCGCTTCACCCTTGTCGACTACAGCATCACCACCGACCGCTCGCAGTCCCC
TGCTCCTCCTGAGCCCGGCAAGGCCCTCAACACCAAGAACCTCAAGCGTCGCTTCACCGGTATTATCGAGATCGA
CAATGTTCAGCATGCCATCACCGGTGTCGGCCCAGGTGCTATTTCCTCCCTGGCTACCGCTCTTTCTACCCTCGG
TATTGATCTCGATGTCCGCGACTACAAGGAACACTCCATTGGTCGCGGTCGCGACACCAAGGCTGCTACCTACAT
TCAGTGCACAGCAGCCGGCAGCAATCAACAGGTGTGGGGTGTTGGTATCCACCAGGATGTGGTCCAGGCCTCTCT
GATTGCGCTGCTTAGCGCCGCCAGCTCGGTAAGATCTGTTCCTGATTTGTCTGCATCTCACCACTAACATGCGTT
TAGTTCCTCACCTCCCGGGCTGGTTCTCCTGCTCCTTTCCGTCCCATCCGCTCCAACACCCTCACCAACGAGGAC
ATCGAAGCTCTCGAGCAGTTGACCAGCACTCCAGAGGCTGTTACATCTAACGGCGGTCTGAGCGCCAAGGCCAAC
ATCGAACAGCTGACAAAAAAGGCTGAAAATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail