Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8671.t1
Gene name
Locationscaffold_35:231159..232776
Strand-
Gene length (bp)1617
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 2.1E-59 12 372
PF11954 DUF3471 Domain of unknown function (DUF3471) 2.1E-14 421 520

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 17.32 8.65 25.98
5d_25C Five days - 25 degrees Celsius 8.60 3.53 13.66
7d_25C Seven days - 25 degrees Celsius 6.53 2.40 10.66
10d_25C Ten days - 25 degrees Celsius 2.42 0.50 4.35
7d_15C Seven days - 15 degrees Celsius 11.76 5.33 18.20
7d_30C Seven days - 30 degrees Celsius 6.19 2.21 10.18

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.016924 yes
3d_25C 7d_25C 0.002761 yes
3d_25C 7d_15C 0.200076 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.485509 no
5d_25C 7d_15C 0.362045 no
5d_25C 7d_30C 0.393039 no
5d_25C 10d_25C 0.001278 yes
7d_25C 7d_15C 0.066809 no
7d_25C 7d_30C 0.924261 no
7d_25C 10d_25C 0.013810 yes
7d_15C 7d_30C 0.050137 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.021163 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8671.t1
MAELPERLDRLRSTIEDLMRIGGTPGLSLAVMSSGNTVYESSFGVRDTAAGLPVTEETIFPICSLTKALTASAMA
ILVDEGKLTWDTLVKDVLPSFDSSDETLQNHLTITDILSHRSGMAWAGNVVLGTENNVLIPGKDGLKYINSQPRV
LPFRTGMSYNNLQYNLAGYVIEEVSGISWFEFVQSRILDPLGLDRTYLKSPPPGTQNVTQCYNALDDGSTTPIPC
PKGGQDWFGGPSGGAWSCIRDLLELYKTFTASFEDQFITGKGATKDSPFKQVSHLTSAKIPMDPPSRNELSYALG
WVRAQLPNRLGHIGINPGLMSNGMPTVGKGVPSQLILFHQGSLPGALAIVILLPDTDSVIVVLSNSLALNDVPDW
VGQLILEELLEVPESERNDYIEAAHISVAESLKWYPALVGELGSARKNGTSPRALEEYVGTYWDNINVFKIVVNL
VDNKLYWRLQGLESEKFQLEHYEDDTFTWLLPRNELSRRGRWVGWDQAAPFWKAVFECNDNGRIDKLVWEHDTGV
PPMQLTKEESTKL*
Coding >Pro_DTO377G3_2|g8671.t1
ATGGCAGAACTCCCGGAACGACTGGATCGCTTGCGGTCCACCATCGAAGATTTGATGCGCATCGGCGGGACCCCA
GGGCTCTCGCTCGCAGTCATGTCGAGCGGAAACACTGTTTACGAGTCAAGTTTTGGCGTCCGAGACACAGCAGCT
GGTCTACCCGTCACTGAGGAAACAATATTTCCCATATGTTCGTTGACAAAGGCTTTGACTGCCTCTGCGATGGCG
ATTCTTGTCGACGAGGGTAAACTCACCTGGGATACACTAGTGAAGGACGTTCTTCCATCCTTTGATTCAAGCGAC
GAGACGCTGCAGAATCACTTGACTATCACGGACATCCTATCTCATCGATCAGGCATGGCTTGGGCTGGTAATGTG
GTCCTCGGTACCGAGAACAACGTTCTCATTCCAGGAAAGGATGGACTGAAATACATCAATTCACAGCCGCGGGTT
CTTCCGTTCCGGACAGGAATGTCCTATAACAATCTTCAATATAACCTTGCAGGTTATGTCATCGAGGAAGTCAGT
GGCATTTCGTGGTTTGAGTTTGTACAGAGCCGTATTCTCGATCCTCTCGGCTTGGATCGAACCTACCTTAAATCT
CCACCTCCGGGCACCCAAAATGTCACTCAGTGCTACAACGCACTTGATGATGGATCCACTACTCCTATTCCTTGC
CCTAAGGGAGGCCAAGATTGGTTTGGTGGACCAAGTGGTGGCGCGTGGTCCTGTATCCGTGATCTTTTGGAGTTA
TACAAAACGTTCACCGCTAGCTTTGAAGATCAATTCATCACCGGGAAGGGAGCGACCAAAGACTCTCCCTTCAAA
CAAGTTTCTCATCTCACTTCCGCCAAAATTCCTATGGATCCACCCTCGAGGAACGAGCTATCATACGCACTCGGA
TGGGTCAGAGCCCAGCTTCCCAATCGGCTAGGTCATATCGGAATCAATCCTGGTCTGATGTCCAATGGCATGCCT
ACCGTTGGGAAAGGCGTTCCCTCACAGCTCATTCTCTTCCACCAGGGCAGCCTACCTGGCGCCCTCGCAATTGTG
ATTCTACTTCCAGACACTGACAGTGTTATTGTTGTACTGTCTAACTCTTTGGCCCTAAATGATGTTCCTGACTGG
GTTGGCCAACTCATCCTTGAAGAGCTGCTCGAGGTTCCAGAATCAGAGAGAAATGATTACATCGAAGCAGCCCAC
ATCTCGGTCGCTGAGAGCTTGAAGTGGTATCCAGCACTGGTGGGAGAGCTAGGCTCGGCTCGAAAGAACGGAACA
TCACCTAGAGCACTAGAGGAGTATGTCGGTACTTACTGGGATAATATCAATGTGTTCAAGATTGTTGTGAATTTG
GTGGACAACAAGCTTTACTGGAGGCTGCAAGGGCTGGAGTCAGAAAAGTTCCAACTTGAACACTATGAAGATGAC
ACCTTCACTTGGTTACTTCCACGGAATGAGTTATCTAGACGTGGCCGCTGGGTGGGCTGGGACCAAGCGGCACCT
TTCTGGAAAGCCGTGTTTGAATGCAACGACAATGGGCGCATTGACAAGTTGGTTTGGGAACACGATACCGGTGTC
CCGCCAATGCAGTTGACGAAGGAGGAAAGCACTAAGCTATGA
Transcript >Pro_DTO377G3_2|g8671.t1
ATGGCAGAACTCCCGGAACGACTGGATCGCTTGCGGTCCACCATCGAAGATTTGATGCGCATCGGCGGGACCCCA
GGGCTCTCGCTCGCAGTCATGTCGAGCGGAAACACTGTTTACGAGTCAAGTTTTGGCGTCCGAGACACAGCAGCT
GGTCTACCCGTCACTGAGGAAACAATATTTCCCATATGTTCGTTGACAAAGGCTTTGACTGCCTCTGCGATGGCG
ATTCTTGTCGACGAGGGTAAACTCACCTGGGATACACTAGTGAAGGACGTTCTTCCATCCTTTGATTCAAGCGAC
GAGACGCTGCAGAATCACTTGACTATCACGGACATCCTATCTCATCGATCAGGCATGGCTTGGGCTGGTAATGTG
GTCCTCGGTACCGAGAACAACGTTCTCATTCCAGGAAAGGATGGACTGAAATACATCAATTCACAGCCGCGGGTT
CTTCCGTTCCGGACAGGAATGTCCTATAACAATCTTCAATATAACCTTGCAGGTTATGTCATCGAGGAAGTCAGT
GGCATTTCGTGGTTTGAGTTTGTACAGAGCCGTATTCTCGATCCTCTCGGCTTGGATCGAACCTACCTTAAATCT
CCACCTCCGGGCACCCAAAATGTCACTCAGTGCTACAACGCACTTGATGATGGATCCACTACTCCTATTCCTTGC
CCTAAGGGAGGCCAAGATTGGTTTGGTGGACCAAGTGGTGGCGCGTGGTCCTGTATCCGTGATCTTTTGGAGTTA
TACAAAACGTTCACCGCTAGCTTTGAAGATCAATTCATCACCGGGAAGGGAGCGACCAAAGACTCTCCCTTCAAA
CAAGTTTCTCATCTCACTTCCGCCAAAATTCCTATGGATCCACCCTCGAGGAACGAGCTATCATACGCACTCGGA
TGGGTCAGAGCCCAGCTTCCCAATCGGCTAGGTCATATCGGAATCAATCCTGGTCTGATGTCCAATGGCATGCCT
ACCGTTGGGAAAGGCGTTCCCTCACAGCTCATTCTCTTCCACCAGGGCAGCCTACCTGGCGCCCTCGCAATTGTG
ATTCTACTTCCAGACACTGACAGTGTTATTGTTGTACTGTCTAACTCTTTGGCCCTAAATGATGTTCCTGACTGG
GTTGGCCAACTCATCCTTGAAGAGCTGCTCGAGGTTCCAGAATCAGAGAGAAATGATTACATCGAAGCAGCCCAC
ATCTCGGTCGCTGAGAGCTTGAAGTGGTATCCAGCACTGGTGGGAGAGCTAGGCTCGGCTCGAAAGAACGGAACA
TCACCTAGAGCACTAGAGGAGTATGTCGGTACTTACTGGGATAATATCAATGTGTTCAAGATTGTTGTGAATTTG
GTGGACAACAAGCTTTACTGGAGGCTGCAAGGGCTGGAGTCAGAAAAGTTCCAACTTGAACACTATGAAGATGAC
ACCTTCACTTGGTTACTTCCACGGAATGAGTTATCTAGACGTGGCCGCTGGGTGGGCTGGGACCAAGCGGCACCT
TTCTGGAAAGCCGTGTTTGAATGCAACGACAATGGGCGCATTGACAAGTTGGTTTGGGAACACGATACCGGTGTC
CCGCCAATGCAGTTGACGAAGGAGGAAAGCACTAAGCTATGA
Gene >Pro_DTO377G3_2|g8671.t1
ATGGCAGAACTCCCGGAACGACTGGATCGCTTGCGGTCCACCATCGAAGATTTGATGCGCATCGGCGGGACCCCA
GGGCTCTCGCTCGCAGTCATGTCGAGCGGAAACACTGTTTACGAGTCAAGTTTTGGCGTCCGAGACACAGCAGCT
GGTCTACCCGTCACTGAGGAAACAATATTTCCCATATGTTCGTTGACAAAGGCTTTGACTGCCTCTGCGATGGCG
ATTCTTGTCGACGAGGGTAAACTCACCTGGGATACACTAGTGAAGGACGTTCTTCCATCCTTTGATTCAAGCGAC
GAGACGCTGCAGAATCACTTGACTATCACGGACATCCTATCTCATCGATCAGGCATGGCTTGGGCTGGTAATGTG
GTCCTCGGTACCGAGAACAACGTTCTCATTCCAGGAAAGGATGGACTGAAATACATCAATTCACAGCCGCGGGTT
CTTCCGTTCCGGACAGGAATGTCCTATAACAATCTTCAATATAACCTTGCAGGTTATGTCATCGAGGAAGTCAGT
GGCATTTCGTGGTTTGAGTTTGTACAGAGCCGTATTCTCGATCCTCTCGGCTTGGATCGAACCTACCTTAAATCT
CCACCTCCGGGCACCCAAAATGTCACTCAGTGCTACAACGCACTTGATGATGGATCCACTACTCCTATTCCTTGC
CCTAAGGGAGGCCAAGATTGGTTTGGTGGACCAAGTGGTGGCGCGTGGTCCTGTATCCGTGATCTTTTGGAGTTA
TACAAAACGTTCACCGCTAGCTTTGAAGATCAATTCATCACCGGGAAGGGAGCGACCAAAGACTCTCCCTTCAAA
CAAGTTTCTCATCTCACTTCCGCCAAAATTCCTATGGATCCACCCTCGAGGAACGAGCTATCATACGCACTCGGA
TGGGTCAGAGCCCAGCTTCCCAATCGGCTAGGTCATATCGGAATCAATCCTGGTCTGATGTCCAATGGCATGCCT
ACCGTTGGGAAAGGCGTTCCCTCACAGCTCATTCTCTTCCACCAGGGCAGCCTACCTGGCGCCCTCGCAATTGTG
ATTCTACTTCCAGACACTGACAGTGTTATTGTTGTACTGTCTAACTCTTTGGCCCTAAATGATGTTCCTGACTGG
GTTGGCCAACTCATCCTTGAAGAGCTGCTCGAGGTTCCAGAATCAGAGAGAAATGATTACATCGAAGCAGCCCAC
ATCTCGGTCGCTGAGAGCTTGAAGTGGTATCCAGCACTGGTGGGAGAGCTAGGCTCGGCTCGAAAGAACGGAACA
TCACCTAGAGCACTAGAGGAGTATGTCGGTACTTACTGGGATAATATCAATGTGTTCAAGATTGTTGTGAATTTG
GTGGACAACAAGCTTTACTGGAGGCTGCAAGGGCTGGAGTCAGAAAAGTTCCAACTTGAACACTATGAAGATGAC
ACCTTCACTTGGTTACTTCCACGGAATGAGTTATCTAGACGTGGCCGCTGGGTGGGCTGGGACCAAGCGGCACCT
TTCTGGAAAGCCGTGTTTGAATGCAACGACAATGGGCGCATTGACAAGTTGGTTTGGGAACACGATACCGGTGTC
CCGCCAATGCAGTTGACGAAGGAGGAAAGCACTAAGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail