Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8670.t1
Gene name
Locationscaffold_35:227856..230538
Strand-
Gene length (bp)2682
Transcript length (bp)2505
Coding sequence length (bp)2505
Protein length (aa) 835

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07971 Glyco_hydro_92 Glycosyl hydrolase family 92 2.7E-147 286 777
PF17678 Glyco_hydro_92N Glycosyl hydrolase family 92 N-terminal domain 1.8E-63 33 280

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 47.29 28.48 66.09
5d_25C Five days - 25 degrees Celsius 21.87 12.18 31.57
7d_25C Seven days - 25 degrees Celsius 22.05 12.09 32.00
10d_25C Ten days - 25 degrees Celsius 13.87 7.00 20.74
7d_15C Seven days - 15 degrees Celsius 25.08 12.26 37.89
7d_30C Seven days - 30 degrees Celsius 21.03 11.46 30.61

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.012303 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.985528 no
5d_25C 7d_15C 0.696276 no
5d_25C 7d_30C 0.923002 no
5d_25C 10d_25C 0.084753 no
7d_25C 7d_15C 0.711208 no
7d_25C 7d_30C 0.905151 no
7d_25C 10d_25C 0.076548 no
7d_15C 7d_30C 0.599037 no
7d_15C 10d_25C 0.030001 yes
7d_30C 10d_25C 0.128640 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8670.t1
MLPYLLLSLFSTSRILVNAADTPLLEDYDVLQYINPLIGSANGGNVFPGASLPYGMAKAVADTDSESNQGGFAHE
GGSVTGFSSMHDSGTGGSPSLGNFPLFPYAKCAGDDVNGCVYPKNQRKTKYKPDSVQARPGYFAIELASGVRVDM
TTAHHTSLFRFQFPSDNTTSPLILLDLTDLSNSRQDNATISVDNTTNRMTGDARFAPSFGSGSYMLHFCADFKSP
AAQRDSGIFVNSRASADVHDLKISRSINGYPLPGGGFVRFESAADNTVLARVGVSFMSTEQACAHAESEIPNFDF
NATHQIAVEKWTEKMRPIRVSRTNIDSSVLSNFYSGIYRTMINPQNYTGENPLWQSSEPYFDSFYCLWDSFRSQI
PFLTIFDPSSVMQMVRSLIDTQRHLGWLPDCRMSLCKGYTQGGSNADNVLADVYLKGLRDGIDWDAGYAAVQKDA
EEEPYDWSSEGRGGLRSWKELHYIPVEDFDYEGFGTMTRSVSRTLEYSYNDFAIAQMARGMNKTADAERYEKRSR
YWQNLFKPNQASFWRGRDTGFTGFFQPKHINGTWGVQDPLACSNIDESGHACSLQNTAGETFESSIWEYQFFVPH
DMQTLITLLGGPTNFVTRLDYLHDRNITYIGNEPAFLTVFQYHYAGRPAKSTSRVRAYIPDYFSPTPAGLPGNDD
SGAMGSFVAMAMMGLFPNPGQSVYLLTVPFFESVSIVSPLTGKTATLRTVNWAEYNTANATGAAAGGNGFIQSAT
LDGVPYTRNWIGHDFFAEGRELVLVLGKEESAWGTGLEDLPPSLAPEAGSGGGDEDVNYRRWESVVESGQLGALH
LDNHVDLVG*
Coding >Pro_DTO377G3_2|g8670.t1
ATGCTACCATATTTGTTACTGTCGTTATTTTCAACCAGTCGCATCCTAGTTAATGCCGCAGACACCCCTCTATTG
GAAGATTATGATGTTCTACAATACATCAATCCCTTGATTGGTAGTGCCAACGGAGGAAATGTGTTTCCAGGAGCC
TCGCTTCCATACGGCATGGCGAAAGCCGTCGCCGATACAGACTCAGAAAGCAACCAAGGAGGTTTCGCCCACGAG
GGCGGCAGCGTCACCGGATTCTCCAGCATGCACGACTCCGGCACTGGCGGCAGTCCTTCGTTAGGGAATTTCCCT
CTCTTTCCCTATGCAAAATGCGCCGGCGATGATGTCAATGGCTGTGTCTATCCGAAGAACCAACGGAAAACGAAG
TATAAGCCCGACTCCGTGCAGGCGCGTCCGGGATACTTTGCTATAGAGCTGGCATCAGGGGTCCGAGTTGATATG
ACAACTGCGCACCATACGTCTCTGTTTCGCTTCCAGTTCCCAAGTGATAACACCACCAGTCCATTGATTTTGCTG
GACCTTACCGATCTGTCGAACTCCCGCCAGGACAATGCGACTATCTCGGTGGATAACACAACAAATCGAATGACC
GGTGATGCGAGGTTCGCTCCTAGCTTTGGATCGGGATCGTACATGTTACATTTCTGTGCGGACTTCAAAAGCCCT
GCAGCCCAGCGAGATAGTGGCATCTTTGTCAATTCTCGTGCCAGTGCTGATGTTCATGATTTGAAAATCTCCCGC
AGTATCAATGGGTACCCGCTTCCAGGTGGTGGATTTGTCCGCTTTGAGTCCGCCGCAGACAACACGGTCCTCGCT
CGAGTTGGCGTCAGCTTCATGAGCACAGAGCAAGCGTGCGCTCATGCAGAGTCTGAGATTCCAAACTTTGACTTC
AACGCAACCCACCAGATAGCAGTCGAAAAATGGACCGAGAAGATGCGCCCGATCCGTGTCTCACGAACAAACATC
GATTCATCCGTTCTGTCCAATTTCTACAGTGGAATCTATCGGACTATGATCAACCCCCAGAACTACACAGGCGAG
AACCCGCTCTGGCAGAGCAGTGAGCCTTACTTTGATTCGTTCTATTGTCTTTGGGATTCTTTCCGTTCCCAGATC
CCATTCCTCACTATCTTCGATCCTTCCTCGGTAATGCAAATGGTGCGATCACTCATCGATACCCAGCGCCACCTA
GGCTGGCTGCCGGACTGCCGCATGTCACTATGCAAAGGATATACACAAGGCGGTTCTAATGCCGACAATGTCCTG
GCAGATGTCTACCTGAAAGGTCTCAGAGATGGCATTGATTGGGATGCCGGGTATGCAGCTGTGCAAAAGGACGCT
GAGGAGGAACCGTACGACTGGTCCAGCGAAGGCCGTGGCGGTCTACGCAGCTGGAAAGAGTTACATTATATCCCT
GTGGAAGACTTCGACTACGAAGGGTTCGGCACAATGACGCGCAGCGTCTCACGCACACTCGAGTATTCCTACAAC
GACTTCGCCATCGCGCAAATGGCTCGAGGCATGAACAAGACGGCCGATGCAGAGCGGTACGAGAAAAGATCACGA
TACTGGCAAAACTTATTCAAACCAAACCAGGCCTCTTTCTGGAGAGGAAGGGACACTGGCTTCACTGGTTTCTTC
CAGCCAAAGCATATTAATGGAACATGGGGCGTCCAAGATCCCCTCGCGTGCTCGAACATCGACGAGAGCGGACAC
GCCTGCTCACTGCAAAACACCGCGGGCGAAACCTTCGAATCCAGCATCTGGGAGTATCAATTCTTCGTCCCCCAC
GACATGCAAACCCTAATAACCCTTCTCGGCGGCCCCACAAACTTCGTCACCCGCCTCGACTACCTCCACGACCGA
AACATAACCTACATCGGCAACGAGCCCGCCTTCCTAACCGTCTTCCAATACCACTACGCCGGCCGTCCAGCAAAA
TCCACCTCCCGCGTGCGCGCCTACATCCCAGACTACTTCTCGCCAACGCCAGCCGGACTCCCAGGCAACGACGAC
TCAGGCGCCATGGGCTCGTTCGTCGCCATGGCGATGATGGGACTATTCCCGAACCCAGGACAGAGCGTGTACCTC
CTCACAGTGCCGTTCTTCGAGTCTGTCAGTATTGTCTCCCCGCTGACGGGGAAAACGGCAACGCTGCGCACGGTG
AATTGGGCGGAGTATAACACGGCTAATGCTACTGGCGCTGCCGCGGGTGGGAATGGCTTTATTCAGTCTGCGACC
CTGGATGGCGTGCCTTATACGCGGAATTGGATTGGGCATGATTTCTTCGCTGAGGGGAGGGAGTTGGTTCTTGTT
CTTGGGAAGGAGGAGAGTGCTTGGGGGACTGGACTGGAGGATTTACCGCCTTCTTTGGCGCCGGAGGCTGGGAGT
GGTGGTGGGGATGAGGATGTGAATTATCGTAGGTGGGAGAGTGTTGTTGAAAGTGGGCAGCTTGGTGCTTTGCAT
CTTGATAATCATGTTGACTTGGTAGGTTGA
Transcript >Pro_DTO377G3_2|g8670.t1
ATGCTACCATATTTGTTACTGTCGTTATTTTCAACCAGTCGCATCCTAGTTAATGCCGCAGACACCCCTCTATTG
GAAGATTATGATGTTCTACAATACATCAATCCCTTGATTGGTAGTGCCAACGGAGGAAATGTGTTTCCAGGAGCC
TCGCTTCCATACGGCATGGCGAAAGCCGTCGCCGATACAGACTCAGAAAGCAACCAAGGAGGTTTCGCCCACGAG
GGCGGCAGCGTCACCGGATTCTCCAGCATGCACGACTCCGGCACTGGCGGCAGTCCTTCGTTAGGGAATTTCCCT
CTCTTTCCCTATGCAAAATGCGCCGGCGATGATGTCAATGGCTGTGTCTATCCGAAGAACCAACGGAAAACGAAG
TATAAGCCCGACTCCGTGCAGGCGCGTCCGGGATACTTTGCTATAGAGCTGGCATCAGGGGTCCGAGTTGATATG
ACAACTGCGCACCATACGTCTCTGTTTCGCTTCCAGTTCCCAAGTGATAACACCACCAGTCCATTGATTTTGCTG
GACCTTACCGATCTGTCGAACTCCCGCCAGGACAATGCGACTATCTCGGTGGATAACACAACAAATCGAATGACC
GGTGATGCGAGGTTCGCTCCTAGCTTTGGATCGGGATCGTACATGTTACATTTCTGTGCGGACTTCAAAAGCCCT
GCAGCCCAGCGAGATAGTGGCATCTTTGTCAATTCTCGTGCCAGTGCTGATGTTCATGATTTGAAAATCTCCCGC
AGTATCAATGGGTACCCGCTTCCAGGTGGTGGATTTGTCCGCTTTGAGTCCGCCGCAGACAACACGGTCCTCGCT
CGAGTTGGCGTCAGCTTCATGAGCACAGAGCAAGCGTGCGCTCATGCAGAGTCTGAGATTCCAAACTTTGACTTC
AACGCAACCCACCAGATAGCAGTCGAAAAATGGACCGAGAAGATGCGCCCGATCCGTGTCTCACGAACAAACATC
GATTCATCCGTTCTGTCCAATTTCTACAGTGGAATCTATCGGACTATGATCAACCCCCAGAACTACACAGGCGAG
AACCCGCTCTGGCAGAGCAGTGAGCCTTACTTTGATTCGTTCTATTGTCTTTGGGATTCTTTCCGTTCCCAGATC
CCATTCCTCACTATCTTCGATCCTTCCTCGGTAATGCAAATGGTGCGATCACTCATCGATACCCAGCGCCACCTA
GGCTGGCTGCCGGACTGCCGCATGTCACTATGCAAAGGATATACACAAGGCGGTTCTAATGCCGACAATGTCCTG
GCAGATGTCTACCTGAAAGGTCTCAGAGATGGCATTGATTGGGATGCCGGGTATGCAGCTGTGCAAAAGGACGCT
GAGGAGGAACCGTACGACTGGTCCAGCGAAGGCCGTGGCGGTCTACGCAGCTGGAAAGAGTTACATTATATCCCT
GTGGAAGACTTCGACTACGAAGGGTTCGGCACAATGACGCGCAGCGTCTCACGCACACTCGAGTATTCCTACAAC
GACTTCGCCATCGCGCAAATGGCTCGAGGCATGAACAAGACGGCCGATGCAGAGCGGTACGAGAAAAGATCACGA
TACTGGCAAAACTTATTCAAACCAAACCAGGCCTCTTTCTGGAGAGGAAGGGACACTGGCTTCACTGGTTTCTTC
CAGCCAAAGCATATTAATGGAACATGGGGCGTCCAAGATCCCCTCGCGTGCTCGAACATCGACGAGAGCGGACAC
GCCTGCTCACTGCAAAACACCGCGGGCGAAACCTTCGAATCCAGCATCTGGGAGTATCAATTCTTCGTCCCCCAC
GACATGCAAACCCTAATAACCCTTCTCGGCGGCCCCACAAACTTCGTCACCCGCCTCGACTACCTCCACGACCGA
AACATAACCTACATCGGCAACGAGCCCGCCTTCCTAACCGTCTTCCAATACCACTACGCCGGCCGTCCAGCAAAA
TCCACCTCCCGCGTGCGCGCCTACATCCCAGACTACTTCTCGCCAACGCCAGCCGGACTCCCAGGCAACGACGAC
TCAGGCGCCATGGGCTCGTTCGTCGCCATGGCGATGATGGGACTATTCCCGAACCCAGGACAGAGCGTGTACCTC
CTCACAGTGCCGTTCTTCGAGTCTGTCAGTATTGTCTCCCCGCTGACGGGGAAAACGGCAACGCTGCGCACGGTG
AATTGGGCGGAGTATAACACGGCTAATGCTACTGGCGCTGCCGCGGGTGGGAATGGCTTTATTCAGTCTGCGACC
CTGGATGGCGTGCCTTATACGCGGAATTGGATTGGGCATGATTTCTTCGCTGAGGGGAGGGAGTTGGTTCTTGTT
CTTGGGAAGGAGGAGAGTGCTTGGGGGACTGGACTGGAGGATTTACCGCCTTCTTTGGCGCCGGAGGCTGGGAGT
GGTGGTGGGGATGAGGATGTGAATTATCGTAGGTGGGAGAGTGTTGTTGAAAGTGGGCAGCTTGGTGCTTTGCAT
CTTGATAATCATGTTGACTTGGTAGGTTGA
Gene >Pro_DTO377G3_2|g8670.t1
ATGCTACCATATTTGTTACTGTCGTTATTTTCAACCAGTCGCATCCTAGTTAATGCCGCAGACACCCCTCTATTG
GAAGATTATGATGTTCTACAATACATCAATCCCTTGATTGGTAGTGCCAACGGAGGTAAGTTCAACAGCTAAATC
AGTCAAATTATCAGTCAAATTCATGCTACTGACCAATTCTCCACAGGAAATGTGTTTCCAGGAGCCTCGCTTCCA
TACGGCATGGCGAAAGCCGTCGCCGATACAGACTCAGAAAGCAACCAAGGAGGTTTCGCCCACGAGGGCGGCAGC
GTCACCGGATTCTCCAGCATGCACGACTCCGGCACTGGCGGCAGTCCTTCGTTAGGGAATTTCCCTCTCTTTCCC
TATGCAAAATGCGCCGGCGATGATGTCAATGGCTGTGTCTATCCGAAGAACCAACGGAAAACGAAGTATAAGCCC
GACTCCGTGCAGGCGCGTCCGGGATACTTTGCTATAGAGCTGGCATCAGGGGTCCGAGTTGATATGACAACTGCG
CACCATACGTCTCTGTTTCGCTTCCAGTTCCCAAGTGATAACACCACCAGTCCATTGATTTTGCTGGACCTTACC
GATCTGTCGAACTCCCGCCAGGACAATGCGACTATCTCGGTGGATAACACAACAAATCGAATGACCGGTGATGCG
AGGTTCGCTCCTAGCTTTGGATCGGGATCGTACATGTTACATTTCTGTGCGGACTTCAAAAGCCCTGCAGCCCAG
CGAGATAGTGGCATCTTTGTCAATTCTCGTGCCAGTGCTGATGTTCATGATTTGAAAATCTCCCGCAGTATCAAT
GGGTACCCGCTTCCAGTGAGTCGAAACCCTTTCTTTTATATAGAGACAAGGATTGACATTCCGTAGGGTGGTGGA
TTTGTCCGCTTTGAGTCCGCCGCAGACAACACGGTCCTCGCTCGAGTTGGCGTCAGCTTCATGAGCACAGAGCAA
GCGTGCGCTCATGCAGAGTCTGAGATTCCAAACTTTGACTTCAACGCAACCCACCAGATAGCAGTCGAAAAATGG
ACCGAGAAGATGCGCCCGATCCGTGTCTCACGAACAAACATCGATTCATCCGTTCTGTCCAATTTCTACAGTGGA
ATCTATCGGACTATGATCAACCCCCAGAACTACACAGGCGAGAACCCGCTCTGGCAGAGCAGTGAGCCTTACTTT
GATTCGTTCTATTGTCTTTGGGATTCTTTCCGTTCCCAGATCCCATTCCTCACTATCTTCGATCCTTCCTCGGTA
ATGCAAATGGTGCGATCACTCATCGATACCCAGCGCCACCTAGGCTGGCTGCCGGACTGCCGCATGTCACTATGC
AAAGGATATACACAAGGCGGTTCTAATGCCGACAATGTCCTGGCAGATGTCTACCTGAAAGGTCTCAGAGATGGC
ATTGATTGGGATGCCGGGTATGCAGCTGTGCAAAAGGACGCTGAGGAGGAACCGTACGACTGGTCCAGCGAAGGC
CGTGGCGGTCTACGCAGCTGGAAAGAGTTACATTATATCCCTGTGGAAGACTTCGACTACGAAGGGTTCGGCACA
ATGACGCGCAGCGTCTCACGCACACTCGAGTATTCCTACAACGACTTCGCCATCGCGCAAATGGCTCGAGGCATG
AACAAGACGGCCGATGCAGAGCGGTACGAGAAAAGATCACGATACTGGCAAAACTTATTCAAACCAAACCAGGCC
TCTTTCTGGAGAGGAAGGGACACTGGCTTCACTGGTTTCTTCCAGCCAAAGCATATTAATGGAACATGGGGCGTC
CAAGATCCCCTCGCGTGCTCGAACATCGACGAGAGCGGACACGCCTGCTCACTGCAAAACACCGCGGGCGAAACC
TTCGAATCCAGCATCTGGGAGTATCAATTGTAAGCCCGCTTCCCCCAACAAATGAAGACCTTTATTCCCACCCCT
TCTAACTATCCCAGCTTCGTCCCCCACGACATGCAAACCCTAATAACCCTTCTCGGCGGCCCCACAAACTTCGTC
ACCCGCCTCGACTACCTCCACGACCGAAACATAACCTACATCGGCAACGAGCCCGCCTTCCTAACCGTCTTCCAA
TACCACTACGCCGGCCGTCCAGCAAAATCCACCTCCCGCGTGCGCGCCTACATCCCAGACTACTTCTCGCCAACG
CCAGCCGGACTCCCAGGCAACGACGACTCAGGCGCCATGGGCTCGTTCGTCGCCATGGCGATGATGGGACTATTC
CCGAACCCAGGACAGAGCGTGTACCTCCTCACAGTGCCGTTCTTCGAGTCTGTCAGTATTGTCTCCCCGCTGACG
GGGAAAACGGCAACGCTGCGCACGGTGAATTGGGCGGAGTATAACACGGCTAATGCTACTGGCGCTGCCGCGGGT
GGGAATGGCTTTATTCAGTCTGCGACCCTGGATGGCGTGCCTTATACGCGGAATTGGATTGGGCATGATTTCTTC
GCTGAGGGGAGGGAGTTGGTTCTTGTTCTTGGGAAGGAGGAGAGTGCTTGGGGGACTGGACTGGAGGATTTACCG
CCTTCTTTGGCGCCGGAGGCTGGGAGTGGTGGTGGGGATGAGGATGTGAATTATCGTAGGTGGGAGAGTGTTGTT
GAAAGTGGGCAGCTTGGTGCTTTGCATCTTGATAATCATGTTGACTTGGTAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail