Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8656.t1
Gene name
Locationscaffold_35:191706..192788
Strand-
Gene length (bp)1082
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.9E-08 4 70
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.8E-12 43 139
PF12796 Ank_2 Ankyrin repeats (3 copies) 8.3E-12 90 170
PF12796 Ank_2 Ankyrin repeats (3 copies) 9.9E-14 113 206
PF13637 Ank_4 Ankyrin repeats (many copies) 9.4E-05 8 58
PF13637 Ank_4 Ankyrin repeats (many copies) 2.3E-06 40 82
PF13637 Ank_4 Ankyrin repeats (many copies) 4.1E-08 112 162
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-10 145 196
PF13857 Ank_5 Ankyrin repeats (many copies) 3.2E-06 37 80
PF13857 Ank_5 Ankyrin repeats (many copies) 6.8E-08 95 149
PF13857 Ank_5 Ankyrin repeats (many copies) 1.2E-07 161 215
PF13606 Ank_3 Ankyrin repeat 2.0E-03 73 103
PF13606 Ank_3 Ankyrin repeat 3.3E-03 142 170
PF00023 Ank Ankyrin repeat 1.6E-03 73 105
PF00023 Ank Ankyrin repeat 6.0E-03 142 173

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8656.t1
MDSDQKFPLHEAAREGRNEVVESLLNANPKSAYVKDDDERLPIHWAVAYNRHPVVELLVAMKDFDPDVEDGSGWT
PLMIAASLKDAAGDATIDLLLRKGADVSIKSHTGQNALHFASSKANLSTVRTLLANKCSARVKDKRGQLPLHRAA
AVGSVPILKLLLEEGKSPVNATDGDGLTALHHAISEGHGPAAIFLLKSGAEAAKRDNEGRLAIQLVPDDKVKQYI
LQTAEKEGIELP*
Coding >Pro_DTO377G3_2|g8656.t1
ATGGATTCCGATCAGAAATTCCCTCTGCACGAGGCTGCCCGAGAAGGAAGAAATGAGGTTGTCGAGTCGTTGCTC
AATGCAAACCCAAAATCCGCATACGTGAAAGATGACGATGAGCGTCTTCCAATCCACTGGGCTGTGGCCTACAAC
CGACACCCGGTCGTGGAATTGCTAGTCGCTATGAAGGACTTCGACCCAGACGTAGAAGATGGATCCGGCTGGACG
CCTCTGATGATTGCAGCTAGCCTGAAAGATGCCGCAGGCGACGCAACGATCGACCTATTACTGCGAAAAGGAGCC
GATGTTTCTATCAAAAGTCACACTGGACAGAATGCGCTGCATTTCGCCAGTTCCAAGGCCAATCTTTCCACCGTC
CGCACCTTGCTTGCCAATAAATGCAGCGCCAGAGTCAAGGATAAACGTGGCCAACTGCCCCTCCACAGAGCAGCC
GCAGTAGGGTCTGTGCCTATCTTGAAGCTCCTCTTGGAAGAGGGTAAGAGTCCTGTCAATGCAACGGATGGTGAC
GGATTAACGGCACTTCATCACGCTATCTCTGAAGGACATGGGCCCGCTGCGATCTTTTTGTTGAAGTCAGGAGCA
GAGGCGGCAAAAAGAGACAATGAAGGTCGACTGGCGATTCAGCTAGTCCCAGATGATAAGGTCAAGCAATACATC
TTACAGACAGCAGAGAAAGAAGGAATTGAACTTCCTTGA
Transcript >Pro_DTO377G3_2|g8656.t1
ATGGATTCCGATCAGAAATTCCCTCTGCACGAGGCTGCCCGAGAAGGAAGAAATGAGGTTGTCGAGTCGTTGCTC
AATGCAAACCCAAAATCCGCATACGTGAAAGATGACGATGAGCGTCTTCCAATCCACTGGGCTGTGGCCTACAAC
CGACACCCGGTCGTGGAATTGCTAGTCGCTATGAAGGACTTCGACCCAGACGTAGAAGATGGATCCGGCTGGACG
CCTCTGATGATTGCAGCTAGCCTGAAAGATGCCGCAGGCGACGCAACGATCGACCTATTACTGCGAAAAGGAGCC
GATGTTTCTATCAAAAGTCACACTGGACAGAATGCGCTGCATTTCGCCAGTTCCAAGGCCAATCTTTCCACCGTC
CGCACCTTGCTTGCCAATAAATGCAGCGCCAGAGTCAAGGATAAACGTGGCCAACTGCCCCTCCACAGAGCAGCC
GCAGTAGGGTCTGTGCCTATCTTGAAGCTCCTCTTGGAAGAGGGTAAGAGTCCTGTCAATGCAACGGATGGTGAC
GGATTAACGGCACTTCATCACGCTATCTCTGAAGGACATGGGCCCGCTGCGATCTTTTTGTTGAAGTCAGGAGCA
GAGGCGGCAAAAAGAGACAATGAAGGTCGACTGGCGATTCAGCTAGTCCCAGATGATAAGGTCAAGCAATACATC
TTACAGACAGCAGAGAAAGAAGGAATTGAACTTCCTTGA
Gene >Pro_DTO377G3_2|g8656.t1
ATGGATTCCGATCAGAAATTCCCTCTGCACGAGGCTGCCCGAGAAGGAAGAAGTGAGAGTTTGACCCTTCTTTGT
ATTAAATAAGCACTAATCTGATTTCTTTAGATGAGGTTGTCGAGTCGTTGCTCAATGTGAGTTGTGCTCCACCTA
GGGCCGAGGCTGCCCCGCAACATCAAGCTCGAGCTGGTACTGTTCGATCTCCCAGAACAAGGCTAATCATCGAAA
CAGGCAAACCCAAAATCCGCATACGTGAAAGATGACGATGAGCGTCTTCCAATCCACTGGGCTGTGGCCTACAAC
CGACACCCGGTCGTGGAATTGCTAGTCGCTATGAAGGACTTCGACCCAGACGTAGAAGTGAGTATCGCTATTCTG
TCTTCGAAAAGAATGCCCAAGCCTTTTCAAAATTGACTAGCCATCGTCATATAAACTTGCTAAATCAGCATAGGA
TGGATCCGGCTGGACGCCTCTGATGATTGCAGCTAGCCTGAAAGATGCCGCAGGCGACGCAACGATCGACCTATT
ACTGCGAAAAGGAGCCGATGTTTCTATCAAAAGTCACACTGGACAGGTCAGCTTTCTGAGACCCGAATTTGGCTA
CTGGATGTACATGAACTTACCATCTAGTAGAATGCGCTGCATTTCGCCAGTTCCAAGGCCAATCTTTCCACCGTC
CGCACCTTGCTTGCCAATAAATGCAGCGCCAGAGTCAAGGATAAACGTGGCCAACTGCCCCTCCACAGAGCAGCC
GCAGTAGGGTCTGTGCCTATCTTGAAGCTCCTCTTGGAAGAGGGTAAGAGTCCTGTCAATGCAACGGATGGTGAC
GGATTAACGGCACTTCATCACGCTATCTCTGAAGGACATGGGCCCGCTGCGATCTTTTTGTTGAAGTCAGGAGCA
GAGGCGGCAAAAAGAGACAATGAAGGTCGACTGGCGATTCAGCTAGTCCCAGATGATAAGGTAAGCACCTCGCCA
TAAATAAGTATCCACTTGGATTAGAATGGCTAATTTATGTTGTGTTTATCCAGGTCAAGCAATACATCTTACAGA
CAGCAGAGAAAGAAGGAATTGAACTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail