Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8653.t1
Gene name
Locationscaffold_35:186387..187533
Strand+
Gene length (bp)1146
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 13.55 5.67 21.43
5d_25C Five days - 25 degrees Celsius 19.43 9.01 29.84
7d_25C Seven days - 25 degrees Celsius 23.13 11.16 35.10
10d_25C Ten days - 25 degrees Celsius 48.88 27.88 69.87
7d_15C Seven days - 15 degrees Celsius 6.81 2.18 11.44
7d_30C Seven days - 30 degrees Celsius 23.50 11.47 35.53

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.289280 no
3d_25C 7d_25C 0.082771 no
3d_25C 7d_15C 0.045183 yes
3d_25C 7d_30C 0.068107 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.635619 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.588971 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.974005 no
7d_25C 10d_25C 0.002761 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.001804 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8653.t1
MMWKASLVMAMAIPLASAALADYALHTVLDNAAPIFGSYKKVTGGKSEWMKKYHDNTLLVHMNIPGTHDSATGSY
NQATQDALRGITDLNQVVVPVPEALTCQDVNFINMLDMGIRAFDLRYAFDPTNTTLIFYHAQALLSEKASVNDVL
FGFYKWLDDHPSETIFLSFQYQGSTALYAENNAAVQLELFNTLTSPAARHYFKQTKDELGTLGDARGKITLMRRF
DLDQLPDNYTAALPGLHFSPNLWNDNGAAIDLVYNSDKNLTAYIEDYYQPLTPTGSSAVENIRWKYNATTENIHK
ATTQHPNSLFWTWASSNNIVNNPPDWPRIMALGNGTHYTPAGGVNQQLVPFLKKQKGKRVGIVMFDFFEQPSNLV
DTLLDL*
Coding >Pro_DTO377G3_2|g8653.t1
ATGATGTGGAAGGCTTCCCTTGTTATGGCCATGGCCATCCCGCTGGCGTCCGCCGCCCTGGCGGATTACGCACTG
CATACAGTCCTTGACAATGCTGCTCCGATCTTTGGATCGTACAAAAAGGTCACAGGGGGAAAGTCGGAATGGATG
AAGAAATATCACGACAACACTTTGCTCGTTCATATGAACATCCCCGGCACCCACGACAGCGCCACGGGAAGTTAC
AACCAGGCGACGCAAGATGCCCTTCGGGGCATTACAGATCTCAACCAGGTCGTTGTTCCGGTGCCAGAGGCATTG
ACGTGCCAGGATGTGAATTTCATCAACATGCTCGACATGGGAATCCGGGCATTTGATCTGCGATATGCTTTCGAT
CCAACAAACACCACTCTCATCTTCTATCATGCACAGGCCCTGCTGTCGGAGAAAGCTAGTGTCAATGATGTGCTC
TTTGGCTTTTACAAGTGGCTGGATGATCACCCCTCGGAGACCATTTTCCTGTCATTCCAGTACCAGGGCTCGACA
GCTCTGTACGCCGAAAACAACGCGGCTGTGCAGTTGGAGCTCTTCAATACCCTCACCAGCCCCGCAGCGCGCCAT
TATTTCAAGCAAACGAAGGATGAATTGGGTACCTTGGGCGACGCACGTGGCAAAATTACTCTCATGCGCCGTTTC
GACCTGGACCAGCTTCCGGATAACTACACAGCCGCACTTCCCGGCCTGCACTTCTCGCCCAATCTCTGGAATGAT
AACGGCGCCGCCATCGACCTGGTGTACAACTCGGACAAGAACTTGACCGCCTACATCGAGGACTACTACCAGCCG
CTCACGCCCACTGGGTCCAGTGCGGTTGAGAACATCAGGTGGAAGTACAACGCCACGACGGAAAACATCCACAAA
GCCACTACCCAGCACCCGAACAGTCTCTTCTGGACATGGGCGTCTAGTAACAATATCGTCAACAACCCTCCCGAT
TGGCCTCGGATCATGGCACTTGGAAACGGCACCCACTATACACCAGCTGGTGGAGTTAACCAGCAGCTAGTGCCT
TTCCTGAAGAAGCAGAAAGGCAAGCGTGTGGGAATCGTGATGTTTGATTTCTTTGAGCAGCCCTCCAACCTGGTT
GATACGCTTTTGGATTTGTGA
Transcript >Pro_DTO377G3_2|g8653.t1
ATGATGTGGAAGGCTTCCCTTGTTATGGCCATGGCCATCCCGCTGGCGTCCGCCGCCCTGGCGGATTACGCACTG
CATACAGTCCTTGACAATGCTGCTCCGATCTTTGGATCGTACAAAAAGGTCACAGGGGGAAAGTCGGAATGGATG
AAGAAATATCACGACAACACTTTGCTCGTTCATATGAACATCCCCGGCACCCACGACAGCGCCACGGGAAGTTAC
AACCAGGCGACGCAAGATGCCCTTCGGGGCATTACAGATCTCAACCAGGTCGTTGTTCCGGTGCCAGAGGCATTG
ACGTGCCAGGATGTGAATTTCATCAACATGCTCGACATGGGAATCCGGGCATTTGATCTGCGATATGCTTTCGAT
CCAACAAACACCACTCTCATCTTCTATCATGCACAGGCCCTGCTGTCGGAGAAAGCTAGTGTCAATGATGTGCTC
TTTGGCTTTTACAAGTGGCTGGATGATCACCCCTCGGAGACCATTTTCCTGTCATTCCAGTACCAGGGCTCGACA
GCTCTGTACGCCGAAAACAACGCGGCTGTGCAGTTGGAGCTCTTCAATACCCTCACCAGCCCCGCAGCGCGCCAT
TATTTCAAGCAAACGAAGGATGAATTGGGTACCTTGGGCGACGCACGTGGCAAAATTACTCTCATGCGCCGTTTC
GACCTGGACCAGCTTCCGGATAACTACACAGCCGCACTTCCCGGCCTGCACTTCTCGCCCAATCTCTGGAATGAT
AACGGCGCCGCCATCGACCTGGTGTACAACTCGGACAAGAACTTGACCGCCTACATCGAGGACTACTACCAGCCG
CTCACGCCCACTGGGTCCAGTGCGGTTGAGAACATCAGGTGGAAGTACAACGCCACGACGGAAAACATCCACAAA
GCCACTACCCAGCACCCGAACAGTCTCTTCTGGACATGGGCGTCTAGTAACAATATCGTCAACAACCCTCCCGAT
TGGCCTCGGATCATGGCACTTGGAAACGGCACCCACTATACACCAGCTGGTGGAGTTAACCAGCAGCTAGTGCCT
TTCCTGAAGAAGCAGAAAGGCAAGCGTGTGGGAATCGTGATGTTTGATTTCTTTGAGCAGCCCTCCAACCTGGTT
GATACGCTTTTGGATTTGTGA
Gene >Pro_DTO377G3_2|g8653.t1
ATGATGTGGAAGGCTTCCCTTGTTATGGCCATGGCCATCCCGCTGGCGTCCGCCGCCCTGGCGGATTACGCACTG
CATACAGTCCTTGACAATGCTGCTCCGATCTTTGGATCGTACAAAAAGGTCACAGGGGGAAAGTCGGAATGGATG
AAGAAATATCACGACAACACTTTGCTCGTTCATATGAACATCCCCGGCACCCACGACAGCGCCACGGGAAGTTAC
AACCAGGCGACGCAAGATGCCCTTCGGGGCATTACAGATCTCAACCAGGTCGTTGTTCCGGTGCCAGAGGCATTG
ACGTGCCAGGATGTGAATTTCATCAACATGCTCGACATGGGAATCCGGGCATTTGATCTGCGATATGCTTTCGAT
CCAACAAACACCACTCTCATCTTCTATCATGCACAGGCCCTGCTGTCGGAGAAAGCTAGTGTCAATGATGTGCTC
TTTGGCTTTTACAAGTGGCTGGATGATCACCCCTCGGAGACCATTTTCCTGTCATTCCAGTACCAGGGCTCGACA
GCTCTGTACGCCGAAAACAACGCGGCTGTGCAGTTGGAGCTCTTCAATACCCTCACCAGCCCCGCAGCGCGCCAT
TATTTCAAGCAAACGAAGGATGAATTGGGTACCTTGGGCGACGCACGTGGCAAAATTACTCTCATGCGCCGTTTC
GACCTGGACCAGCTTCCGGATAACTACACAGCCGCACTTCCCGGCCTGCACTTCTCGCCCAATCTCTGGAATGAT
AACGGCGCCGCCATCGACCTGGTGTACAACTCGGACAAGAACTTGACCGCCTACATCGAGGACTACTACCAGCCG
CTCACGCCCACTGGGTCCAGTGCGGTTGAGAACATCAGGTGGAAGTACAACGCCACGACGGAAAACATCCACAAA
GCCACTACCCAGCACCCGAACAGTCTCTTCTGGACATGGGCGTCTAGTAACAATATCGTCAACAACCCTCCCGAT
TGGCCTCGGATCATGGCACTTGGAAACGGCACCCACTATACACCAGCTGGTGGAGTTAACCAGCAGCTAGTGCCT
TTCCTGAAGAAGCAGAAAGGCAAGCGTGTGGGAATCGTGATGTTTGATTTCTTTGAGCAGCCCTCCAACCTGGTT
GATACGCTTTTGGATTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail