Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8649.t1
Gene name
Locationscaffold_35:177748..179299
Strand+
Gene length (bp)1551
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03224 V-ATPase_H_N V-ATPase subunit H 4.8E-81 8 350
PF11698 V-ATPase_H_C V-ATPase subunit H 8.8E-36 357 475

GO

GO Term Description Terminal node
GO:0046961 proton-transporting ATPase activity, rotational mechanism Yes
GO:1902600 proton transmembrane transport Yes
GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain Yes
GO:0015399 primary active transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0015078 proton transmembrane transporter activity No
GO:0032991 protein-containing complex No
GO:0098655 cation transmembrane transport No
GO:0022804 active transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0009678 pyrophosphate hydrolysis-driven proton transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0042625 ATPase-coupled ion transmembrane transporter activity No
GO:0019829 ATPase-coupled cation transmembrane transporter activity No
GO:0055085 transmembrane transport No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0033180 proton-transporting V-type ATPase, V1 domain No
GO:0009987 cellular process No
GO:0098796 membrane protein complex No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0051179 localization No
GO:0015075 ion transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0098660 inorganic ion transmembrane transport No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0033178 proton-transporting two-sector ATPase complex, catalytic domain No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 134.24 81.81 186.67
5d_25C Five days - 25 degrees Celsius 181.79 110.39 253.20
7d_25C Seven days - 25 degrees Celsius 205.39 124.00 286.77
10d_25C Ten days - 25 degrees Celsius 286.09 168.06 404.12
7d_15C Seven days - 15 degrees Celsius 155.58 94.48 216.68
7d_30C Seven days - 30 degrees Celsius 169.60 103.09 236.11

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.177837 no
3d_25C 7d_25C 0.046955 yes
3d_25C 7d_15C 0.577587 no
3d_25C 7d_30C 0.323665 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.661811 no
5d_25C 7d_15C 0.548198 no
5d_25C 7d_30C 0.817975 no
5d_25C 10d_25C 0.037576 yes
7d_25C 7d_15C 0.229796 no
7d_25C 7d_30C 0.440087 no
7d_25C 10d_25C 0.152189 no
7d_15C 7d_30C 0.767240 no
7d_15C 10d_25C 0.003625 yes
7d_30C 10d_25C 0.012303 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8649.t1
MSLEPPTYLSSLQNNIRARPIPWEGAVRAGNITDDHLKKIKAVDKVRKEQRRQTIEGDLAGYTDLLAGGAHGKSV
LDSASRRTDIVQYILVLASDLIQDVPALANSLVSHPEPYKPFLPFLQHSANAEDPIPLLTSTFLTALVSHSLVAS
SKPAPRDNEALPQLYTYLSTLTKNQDSGLQDIGVQGFSELLRTSRAREIFWAQRQETLTPLIDTLRAAAGAKDNV
SNASTLGSSTRSVEPGLAGGIGLQLLYRVLLVLWQLAFEGALVGDELQENYEIIQLYIHLLRLSPKEKTTRLLVA
TLYSLCSSNRTTLLPIAVFLRLPALLTNLSGRHLTDPDLLEDLNALSSMLEEYTKTQTTFDEYAAEVQTGHLRWS
PPHKNPTFWKDNARRIVEESNGALPKKLAEILSKSWDNDKQVLAIACSDVGNLVKEVPERRGQLERLGLKTRVME
LMVDQDESVRWESLHAVGEWLRYTFEG*
Coding >Pro_DTO377G3_2|g8649.t1
ATGTCACTGGAGCCACCCACCTACCTCAGCTCCCTCCAGAATAACATCCGAGCTCGGCCAATTCCGTGGGAGGGT
GCCGTCCGGGCGGGCAACATCACCGATGACCACTTGAAGAAGATCAAGGCGGTGGATAAGGTGCGCAAGGAGCAA
CGCCGTCAGACGATAGAAGGAGATCTTGCTGGATACACAGATCTGTTGGCCGGCGGTGCACACGGAAAGAGTGTC
TTGGACTCGGCCTCGAGAAGGACCGATATTGTGCAGTATATACTGGTGCTGGCCTCGGACTTGATTCAAGATGTG
CCTGCTTTGGCCAACTCGCTTGTTTCTCACCCCGAACCGTACAAGCCCTTCCTACCATTCTTGCAGCACTCGGCA
AACGCCGAAGACCCCATTCCTCTGCTCACGTCCACCTTCCTCACGGCGCTCGTGTCGCACAGTCTCGTTGCCTCA
TCTAAACCTGCACCCCGCGACAATGAGGCTCTTCCACAGCTCTACACCTATCTCTCTACCTTGACCAAGAATCAG
GATAGTGGACTCCAGGATATTGGTGTCCAAGGATTCTCTGAGCTGCTAAGAACAAGCCGAGCCCGAGAAATCTTT
TGGGCGCAACGTCAAGAGACCTTGACCCCCTTGATCGACACTCTTCGAGCTGCGGCGGGTGCTAAAGACAACGTC
AGTAACGCAAGCACACTGGGAAGCAGCACTCGCAGCGTCGAGCCTGGTCTCGCCGGTGGTATTGGCCTTCAGCTT
CTATATCGGGTGCTCCTTGTTCTATGGCAGCTTGCGTTTGAAGGCGCTCTCGTTGGTGATGAACTTCAAGAGAAC
TATGAAATTATCCAACTGTACATCCACCTTCTGCGTCTCTCACCGAAAGAAAAGACCACTCGGTTGCTTGTTGCA
ACTCTGTACAGTCTTTGCTCCAGCAACCGGACAACTCTGCTACCCATCGCCGTGTTCCTTCGACTGCCCGCCCTC
CTGACTAACTTGTCTGGTCGTCATCTGACCGATCCCGACCTGCTCGAAGATCTCAACGCACTCTCTTCCATGCTG
GAGGAGTACACCAAGACACAGACCACCTTTGACGAATATGCCGCCGAAGTTCAGACTGGCCACCTCCGCTGGTCG
CCCCCTCACAAGAACCCGACCTTCTGGAAAGATAACGCTCGACGAATTGTTGAGGAGTCGAACGGCGCTTTGCCC
AAGAAACTGGCCGAGATCCTATCTAAGAGTTGGGATAACGACAAGCAGGTACTGGCTATTGCTTGCAGCGACGTA
GGTAACTTAGTGAAGGAGGTTCCCGAACGCCGTGGGCAGTTGGAGCGACTAGGCCTAAAGACGCGGGTGATGGAA
CTGATGGTTGATCAAGATGAATCAGTACGGTGGGAGAGCTTGCACGCTGTCGGCGAATGGCTTCGATATACCTTT
GAGGGCTGA
Transcript >Pro_DTO377G3_2|g8649.t1
ATGTCACTGGAGCCACCCACCTACCTCAGCTCCCTCCAGAATAACATCCGAGCTCGGCCAATTCCGTGGGAGGGT
GCCGTCCGGGCGGGCAACATCACCGATGACCACTTGAAGAAGATCAAGGCGGTGGATAAGGTGCGCAAGGAGCAA
CGCCGTCAGACGATAGAAGGAGATCTTGCTGGATACACAGATCTGTTGGCCGGCGGTGCACACGGAAAGAGTGTC
TTGGACTCGGCCTCGAGAAGGACCGATATTGTGCAGTATATACTGGTGCTGGCCTCGGACTTGATTCAAGATGTG
CCTGCTTTGGCCAACTCGCTTGTTTCTCACCCCGAACCGTACAAGCCCTTCCTACCATTCTTGCAGCACTCGGCA
AACGCCGAAGACCCCATTCCTCTGCTCACGTCCACCTTCCTCACGGCGCTCGTGTCGCACAGTCTCGTTGCCTCA
TCTAAACCTGCACCCCGCGACAATGAGGCTCTTCCACAGCTCTACACCTATCTCTCTACCTTGACCAAGAATCAG
GATAGTGGACTCCAGGATATTGGTGTCCAAGGATTCTCTGAGCTGCTAAGAACAAGCCGAGCCCGAGAAATCTTT
TGGGCGCAACGTCAAGAGACCTTGACCCCCTTGATCGACACTCTTCGAGCTGCGGCGGGTGCTAAAGACAACGTC
AGTAACGCAAGCACACTGGGAAGCAGCACTCGCAGCGTCGAGCCTGGTCTCGCCGGTGGTATTGGCCTTCAGCTT
CTATATCGGGTGCTCCTTGTTCTATGGCAGCTTGCGTTTGAAGGCGCTCTCGTTGGTGATGAACTTCAAGAGAAC
TATGAAATTATCCAACTGTACATCCACCTTCTGCGTCTCTCACCGAAAGAAAAGACCACTCGGTTGCTTGTTGCA
ACTCTGTACAGTCTTTGCTCCAGCAACCGGACAACTCTGCTACCCATCGCCGTGTTCCTTCGACTGCCCGCCCTC
CTGACTAACTTGTCTGGTCGTCATCTGACCGATCCCGACCTGCTCGAAGATCTCAACGCACTCTCTTCCATGCTG
GAGGAGTACACCAAGACACAGACCACCTTTGACGAATATGCCGCCGAAGTTCAGACTGGCCACCTCCGCTGGTCG
CCCCCTCACAAGAACCCGACCTTCTGGAAAGATAACGCTCGACGAATTGTTGAGGAGTCGAACGGCGCTTTGCCC
AAGAAACTGGCCGAGATCCTATCTAAGAGTTGGGATAACGACAAGCAGGTACTGGCTATTGCTTGCAGCGACGTA
GGTAACTTAGTGAAGGAGGTTCCCGAACGCCGTGGGCAGTTGGAGCGACTAGGCCTAAAGACGCGGGTGATGGAA
CTGATGGTTGATCAAGATGAATCAGTACGGTGGGAGAGCTTGCACGCTGTCGGCGAATGGCTTCGATATACCTTT
GAGGGCTGA
Gene >Pro_DTO377G3_2|g8649.t1
ATGTCACTGGAGCCACCCACCTACCTCAGCTCCCTCCAGAATAACATCCGAGCTCGGCCAATTCCGTGGGAGGGT
GCCGTCCGGGCGGGCAACATCACCGATGACCACTTGAAGAAGATCAAGGCGGTGGATAAGGTGCGCAAGGAGCAA
CGCCGTCAGACGATAGAAGGAGATCTTGCTGGATACACAGATCTGTTGGCCGGCGGTGCACACGGAAAGAGTGTC
TTGGACTCGGCCTCGAGAAGGACCGATATTGTGCAGTATATACTGGTGCTGGCCTCGGACTTGATTCAAGGTATA
ACCTACTAGCGGAGCTGAAGTTCTGAGGAATCATACTGACTCATATTAAAAAAGATGTGCCTGCTTTGGCCAACT
CGCTTGTTTCTCACCCCGAACCGTACAAGCCCTTCCTACCATTCTTGCAGCACTCGGCAAACGCCGAAGACCCCA
TTCCTCTGCTCACGTCCACCTTCCTCACGGCGCTCGTGTCGCACAGTCTCGTTGCCTCATCTAAACCTGCACCCC
GCGACAATGAGGCTCTTCCACAGCTCTACACCTATCTCTCTACCTTGACCAAGAATCAGGATAGTGGACTCCAGG
ATATTGGTGTCCAAGGATTCTCTGAGCTGCTAAGAACAAGCCGAGCCCGAGAAATCTTTTGGGCGCAACGTCAAG
AGACCTTGACCCCCTTGATCGACACTCTTCGAGCTGCGGCGGGTGCTAAAGACAACGTCAGTAACGCAAGCACAC
TGGGAAGCAGCACTCGCAGCGTCGAGCCTGGTCTCGCCGGTGGTATTGGCCTTCAGCTTCTATATCGGGTGCTCC
TTGTTCTATGGCAGCTTGCGTTTGAAGGCGCTCTCGTTGGTGATGAACTTCAAGAGTGAGTGATGTGAAGACAAG
AGATCGAATATACACTCTGAGCTACTAACCCCACACAGGAACTATGAAATTATCCAACTGTACATCCACCTTCTG
CGTCTCTCACCGAAAGAAAAGACCACTCGGTTGCTTGTTGCAACTCTGTACAGTCTTTGCTCCAGCAACCGGACA
ACTCTGCTACCCATCGCCGTGTTCCTTCGACTGCCCGCCCTCCTGACTAACTTGTCTGGTCGTCATCTGACCGAT
CCCGACCTGCTCGAAGATCTCAACGCACTCTCTTCCATGCTGGAGGAGTACACCAAGACACAGACCACCTTTGAC
GAATATGCCGCCGAAGTTCAGACTGGCCACCTCCGCTGGTCGCCCCCTCACAAGAACCCGACCTTCTGGAAAGAT
AACGCTCGACGAATTGTTGAGGAGTCGAACGGCGCTTTGCCCAAGAAACTGGCCGAGATCCTATCTAAGAGTTGG
GATAACGACAAGCAGGTACTGGCTATTGCTTGCAGCGACGTAGGTAACTTAGTGAAGGAGGTTCCCGAACGCCGT
GGGCAGTTGGAGCGACTAGGCCTAAAGACGCGGGTGATGGAACTGATGGTTGATCAAGATGAATCAGTACGGTGG
GAGAGCTTGCACGCTGTCGGCGAATGGCTTCGATATACCTTTGAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail