Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8646.t1
Gene name
Locationscaffold_35:171116..172190
Strand-
Gene length (bp)1074
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 50 68 18
3 80 102 22
4 112 134 22
5 147 164 17
6 179 201 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.08 0.00 2.36
5d_25C Five days - 25 degrees Celsius 0.72 0.00 1.74
7d_25C Seven days - 25 degrees Celsius 0.77 0.00 1.83
10d_25C Ten days - 25 degrees Celsius 0.44 0.00 1.14
7d_15C Seven days - 15 degrees Celsius 2.09 0.00 4.48
7d_30C Seven days - 30 degrees Celsius 4.12 0.32 7.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.681157 no
3d_25C 7d_25C 0.739551 no
3d_25C 7d_15C 0.374232 no
3d_25C 7d_30C 0.034125 yes
3d_25C 10d_25C 0.355909 no
5d_25C 7d_25C 0.969816 no
5d_25C 7d_15C 0.187895 no
5d_25C 7d_30C 0.030434 yes
5d_25C 10d_25C 0.676903 no
7d_25C 7d_15C 0.250917 no
7d_25C 7d_30C 0.053498 no
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.314955 no
7d_15C 10d_25C 0.120090 no
7d_30C 10d_25C 0.040199 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8646.t1
MDMDELNHPAINIWTFFALAVLDIAVNAAAGPAAVATAAHVNGSPLTARALQLGALAGVTKSGVLAFIEFAGYAG
LPTPAWILLALVASGFGTCVLVTAEISNLVLGETPSALLIAAVVAAIPLSGECMGIYQSAGGLYGGKPQTQLCVM
GFNALGGYVFARMAHNGGYDVCPYSVAAAAGAVYGVITGFFHVILGCLAGFTHYESTNGEYEIRNVFGVARGYNP
NWARNVGHGV*
Coding >Pro_DTO377G3_2|g8646.t1
ATGGATATGGACGAGCTCAATCATCCTGCTATTAACATATGGACGTTCTTCGCCTTGGCTGTGCTAGACATTGCA
GTAAACGCTGCCGCCGGTCCAGCTGCAGTGGCGACCGCCGCGCATGTCAATGGGAGCCCACTGACAGCGAGAGCA
CTACAACTCGGTGCGCTCGCTGGAGTCACTAAATCAGGGGTGTTAGCATTTATCGAATTCGCAGGGTACGCGGGC
TTGCCAACGCCCGCGTGGATACTGTTGGCTCTGGTGGCAAGTGGCTTTGGAACTTGTGTCCTGGTCACGGCGGAG
ATTAGCAATTTGGTTCTTGGAGAAACACCAAGCGCATTGCTTATTGCGGCTGTTGTCGCTGCTATTCCCCTCTCG
GGAGAATGTATGGGGATATATCAATCGGCTGGGGGGCTATATGGTGGCAAACCTCAGACACAACTTTGTGTTATG
GGGTTCAATGCCTTGGGAGGATACGTCTTTGCTCGTATGGCACATAACGGAGGCTACGATGTCTGCCCTTACAGT
GTTGCTGCCGCAGCTGGGGCTGTTTACGGTGTCATCACCGGCTTCTTCCATGTCATCCTTGGTTGTCTAGCCGGA
TTCACCCACTATGAAAGCACAAATGGGGAATATGAGATACGGAATGTATTTGGGGTTGCGCGAGGGTATAATCCC
AATTGGGCACGAAATGTCGGGCATGGAGTCTGA
Transcript >Pro_DTO377G3_2|g8646.t1
ATGGATATGGACGAGCTCAATCATCCTGCTATTAACATATGGACGTTCTTCGCCTTGGCTGTGCTAGACATTGCA
GTAAACGCTGCCGCCGGTCCAGCTGCAGTGGCGACCGCCGCGCATGTCAATGGGAGCCCACTGACAGCGAGAGCA
CTACAACTCGGTGCGCTCGCTGGAGTCACTAAATCAGGGGTGTTAGCATTTATCGAATTCGCAGGGTACGCGGGC
TTGCCAACGCCCGCGTGGATACTGTTGGCTCTGGTGGCAAGTGGCTTTGGAACTTGTGTCCTGGTCACGGCGGAG
ATTAGCAATTTGGTTCTTGGAGAAACACCAAGCGCATTGCTTATTGCGGCTGTTGTCGCTGCTATTCCCCTCTCG
GGAGAATGTATGGGGATATATCAATCGGCTGGGGGGCTATATGGTGGCAAACCTCAGACACAACTTTGTGTTATG
GGGTTCAATGCCTTGGGAGGATACGTCTTTGCTCGTATGGCACATAACGGAGGCTACGATGTCTGCCCTTACAGT
GTTGCTGCCGCAGCTGGGGCTGTTTACGGTGTCATCACCGGCTTCTTCCATGTCATCCTTGGTTGTCTAGCCGGA
TTCACCCACTATGAAAGCACAAATGGGGAATATGAGATACGGAATGTATTTGGGGTTGCGCGAGGGTATAATCCC
AATTGGGCACGAAATGTCGGGCATGGAGTCTGA
Gene >Pro_DTO377G3_2|g8646.t1
ATGGATATGGACGAGCTCAATCATCCTGCTATTAACAGTAAGTGTCATGTTTTGGACCCAGAGGAAATCAGAATG
ACTTCCTACATGTGACTTCATCATGCCTCCACTCAATACTTACCATGTCCCTTACTCTAGTATGGACGTTCTTCG
CCTTGGCTGTGCTAGACATTGCAGTAAACGCTGCCGCCGGTCCAGCTGCAGTGGCGACCGCCGCGCATGTCAATG
GGAGCCCACTGACAGCGAGAGCACTACAACTCGGTGCGCTCGCTGGAGTCACTAAATCAGGGGTGTTAGCATTTA
TCGAATTCGCAGGGTACGCGGGCTTGCCAACGCCCGCGTGGATACTGTTGGCTCTGGTGGCAAGTGGCTTTGGAA
CTTGTGTCCTGGTCACGGCGGAGATTAGCAATTTGGTTCTTGGAGAAAGTGAGTGGAAACCCGTCCACTGAAGCA
CTGTTCAGCTAGAGCTCTGTGCGGCTCACGTTGGCGGTCATTATCATGACCCATCTAGTCATTGTACTAACGATA
TATAGCACCAAGCGCATTGCTTATTGCGGCTGTTGTCGCTGCTATTCCCCTCTCGGGAGAATGTATGGGGATATA
TCAATGTAAGTCTTTTCTCCTCGCTTGCAGCTCCGTTGCTAATCTTTTCCTGTCCTTCAGCGGCTGGGGGGCTAT
ATGGTGGCAAACCTCAGACACAACTTTGTGTTATGGGGTTCAATGCCTTGGGAGGATACGTCTTTGCTCGTATGG
CACATAACGGAGGTTCGTTGCCGTCTCTCCTACATCATGAAAGCTTCGGGGTCGCTCTCTTCGCTGCTCCTGTTG
GATCGGTTGAATGATTTAACTAATACTTAACTTGAACCTGCAGGCTACGATGTCTGCCCTTACAGTGTTGCTGCC
GCAGCTGGGGCTGTTTACGGTGTCATCACCGGCTTCTTCCATGTCATCCTTGGTTGTCTAGCCGGATTCACCCAC
TATGAAAGCACAAATGGGGAATATGAGATACGGAATGTATTTGGGGTTGCGCGAGGGTATAATCCCAATTGGGCA
CGAAATGTCGGGCATGGAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail