Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8626.t1
Gene name
Locationscaffold_35:107261..110553
Strand-
Gene length (bp)3292
Transcript length (bp)2781
Coding sequence length (bp)2781
Protein length (aa) 927

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11635 Med16 Mediator complex subunit 16 1.1E-204 138 903

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005575 cellular_component No
GO:0044422 organelle part No
GO:0044451 nucleoplasm part No
GO:0044428 nuclear part No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8626.t1
MEDGIDVDDLFGEPNSLELGLPTASPIKGLAQCLDEMRLSGCCQKIAWSRMGCIASISPDGIRVIIRYLQCRPSD
GKWVLGEESSLAPVLEAHNGTQLAHLSWNETGSELAVVDCSGRVSIYSISIALNSITGLRQASFDSGDDGSQVVG
MMWLNSQRYVHAFHQAAKVNGRWAYSPFRRRPVGPFHPANKGALICVTRAGQIKLIYQNPDSKWAELPAELKNTG
YSDRLLTHASMTATQAGILLSTYSACQKMCLYRVHISWNPPQWEPAQGKLPGQFPIPTFRLIHCKVDMPNNILNV
NRGPDHHDQSLPFLNSVYSLTRLEIMPGQFDSLAGSTANPWILAVLSKPLHAMHDYPDQQGPPSVIVRWHLESAP
QILHPKFDEVTSKKSNAQAKPKMELRRLENVYCDKYIVSVDLVEHGTVLAVSHDDSSITCYDTRTMAVLNGLDDS
SAVTCLAQAGFQYPLETSGLHIAFSPNACVAVTLDSDGHMQLRAMEHSFGSTEGLYDENNLSAAIAALTLAFSRG
CGVDYNTDDILMVALGQLSLEAQTTFISEVYRALPVNCNFTAEQDKLMSHPYIPRCLSLQAGLGFKGRLKRRNLS
SAVPWASLQLRHASVLFAYFFQYNKGGQTESHDPDVLRMVLGNTKWTLDFSHFLLSEIFDMADEFEDVFDDSEAF
TQKLKNSSSLPLLILLSSMSRAFLRFICRGLRGVHAGFASANPASLLGDSRIYYTEICQTLESSPVRIDVYEKFL
AGVDSAVKHAYQGAGFGDAERPGPEKELLVNARIPPVLTTAVATLLRQTVPALKSEINRMAIYLGDYSWLGFGND
RRTALYRRHREVDILKKCPLRPPLPLGNDGRVAPVKKRRCARCCEVSGDTNLPRSLLSFKMIAKLGLLRSCLCGG
MWVLETDTGVLGIGTASANGNGNRIT*
Coding >Pro_DTO377G3_2|g8626.t1
ATGGAGGACGGTATCGATGTGGATGATCTCTTTGGAGAACCCAACTCCCTGGAGCTGGGCTTGCCGACCGCCTCC
CCAATCAAAGGTCTAGCACAATGCTTAGATGAAATGCGTCTATCAGGGTGCTGCCAGAAAATCGCCTGGTCTCGG
ATGGGATGTATTGCATCTATTTCCCCAGACGGAATCCGGGTTATTATCCGCTATCTCCAATGCCGCCCATCAGAT
GGCAAATGGGTGCTCGGGGAAGAGTCATCTTTGGCTCCAGTCTTGGAGGCCCATAATGGCACTCAACTGGCCCAT
CTATCATGGAATGAAACAGGCTCAGAACTGGCCGTTGTCGACTGTTCCGGTCGGGTATCAATCTATTCCATTTCA
ATTGCACTGAACAGCATCACAGGCTTGCGTCAAGCCTCATTTGACTCCGGCGATGATGGCAGCCAGGTTGTTGGG
ATGATGTGGCTGAACTCCCAGCGTTATGTGCATGCATTTCATCAAGCAGCCAAGGTGAATGGCCGATGGGCATAT
TCGCCTTTCCGTCGACGCCCCGTCGGGCCATTCCACCCAGCCAACAAAGGCGCACTGATATGTGTGACCAGAGCC
GGCCAGATCAAGCTGATATATCAAAACCCCGACAGCAAATGGGCCGAGCTGCCAGCCGAACTGAAGAACACAGGG
TACTCGGATAGACTATTAACGCATGCATCCATGACCGCAACACAAGCTGGGATCCTTCTCTCCACCTACTCCGCA
TGCCAGAAAATGTGTCTTTATAGAGTGCACATCAGCTGGAACCCGCCACAATGGGAGCCGGCACAGGGAAAACTG
CCTGGCCAATTCCCTATCCCCACCTTCCGTTTGATCCACTGTAAAGTCGACATGCCTAACAATATATTGAACGTT
AACCGGGGCCCGGACCATCACGATCAGTCTTTGCCGTTTTTGAACTCGGTATACTCGTTGACACGACTAGAGATC
ATGCCGGGACAGTTTGATAGCCTCGCGGGGTCCACTGCTAACCCTTGGATCCTGGCTGTCTTATCGAAGCCTCTC
CACGCCATGCATGATTATCCAGACCAGCAAGGCCCACCGAGTGTGATTGTCAGGTGGCATTTGGAATCTGCCCCG
CAGATCCTCCATCCCAAGTTTGACGAAGTGACGTCAAAAAAGAGCAACGCTCAAGCAAAGCCCAAAATGGAACTG
CGGAGGCTGGAGAATGTTTATTGCGATAAGTACATTGTCTCGGTCGATTTAGTAGAGCATGGGACAGTCTTGGCT
GTCAGTCATGATGACAGCTCAATAACTTGCTACGACACACGGACAATGGCCGTTCTGAACGGTCTTGACGATTCA
AGCGCAGTGACCTGTCTGGCCCAGGCTGGGTTCCAGTACCCGCTCGAAACATCAGGTCTTCACATTGCTTTCTCT
CCTAATGCTTGCGTTGCCGTCACGCTGGATAGTGACGGACATATGCAACTGAGGGCGATGGAGCATTCATTTGGA
TCCACGGAGGGTCTCTATGACGAGAACAATCTTTCCGCGGCCATTGCGGCTTTGACATTGGCATTCAGTCGAGGA
TGTGGCGTTGATTATAATACAGATGACATACTCATGGTTGCTCTTGGGCAGCTATCACTAGAGGCTCAAACCACA
TTCATCAGCGAGGTGTACCGTGCACTGCCAGTCAATTGCAACTTTACAGCCGAACAGGACAAACTCATGAGCCAT
CCGTACATACCTCGTTGTCTCAGCTTACAGGCCGGACTGGGCTTCAAAGGGAGACTCAAGCGCCGCAACCTCTCA
TCGGCCGTGCCATGGGCAAGCCTTCAACTCAGACATGCCTCAGTTCTATTCGCATATTTCTTCCAGTATAATAAG
GGAGGCCAGACAGAATCGCATGATCCAGACGTTCTACGCATGGTATTGGGTAACACCAAATGGACACTAGACTTC
TCTCATTTTCTTCTGAGCGAAATCTTCGACATGGCCGACGAATTCGAAGATGTATTCGATGATTCAGAAGCATTC
ACACAGAAGTTGAAAAACTCTTCCTCTCTCCCCCTCCTAATCCTCCTCTCAAGCATGTCGCGCGCCTTCCTCCGC
TTCATCTGCCGTGGCCTCCGCGGCGTGCACGCTGGTTTCGCTAGCGCAAACCCCGCCTCTCTTCTAGGCGACTCC
CGAATCTACTACACAGAGATCTGCCAAACACTAGAATCATCGCCGGTACGAATCGACGTGTATGAGAAGTTCCTG
GCAGGAGTGGACTCAGCCGTGAAGCACGCCTACCAAGGCGCTGGCTTCGGCGATGCCGAAAGACCCGGCCCGGAA
AAGGAATTGCTGGTTAATGCGCGCATCCCGCCAGTCCTCACTACTGCCGTGGCCACCCTCCTCCGACAGACAGTC
CCGGCGCTCAAATCCGAGATCAACCGCATGGCGATCTACCTCGGGGACTATAGCTGGCTTGGTTTTGGAAATGAC
CGACGCACGGCGCTGTACCGGAGGCACCGTGAGGTCGATATCCTCAAGAAGTGCCCGCTGCGCCCGCCGTTGCCG
TTGGGGAATGATGGTCGCGTGGCGCCGGTAAAGAAACGCCGGTGTGCGCGTTGCTGTGAAGTCTCTGGTGATACG
AATCTGCCCCGGTCGCTTCTGTCGTTCAAGATGATTGCTAAGCTGGGGCTGTTGCGGTCTTGTCTTTGCGGGGGC
ATGTGGGTTCTTGAGACAGATACTGGGGTTCTGGGGATTGGTACTGCGAGTGCAAATGGCAATGGCAACCGGATT
ACCTAG
Transcript >Pro_DTO377G3_2|g8626.t1
ATGGAGGACGGTATCGATGTGGATGATCTCTTTGGAGAACCCAACTCCCTGGAGCTGGGCTTGCCGACCGCCTCC
CCAATCAAAGGTCTAGCACAATGCTTAGATGAAATGCGTCTATCAGGGTGCTGCCAGAAAATCGCCTGGTCTCGG
ATGGGATGTATTGCATCTATTTCCCCAGACGGAATCCGGGTTATTATCCGCTATCTCCAATGCCGCCCATCAGAT
GGCAAATGGGTGCTCGGGGAAGAGTCATCTTTGGCTCCAGTCTTGGAGGCCCATAATGGCACTCAACTGGCCCAT
CTATCATGGAATGAAACAGGCTCAGAACTGGCCGTTGTCGACTGTTCCGGTCGGGTATCAATCTATTCCATTTCA
ATTGCACTGAACAGCATCACAGGCTTGCGTCAAGCCTCATTTGACTCCGGCGATGATGGCAGCCAGGTTGTTGGG
ATGATGTGGCTGAACTCCCAGCGTTATGTGCATGCATTTCATCAAGCAGCCAAGGTGAATGGCCGATGGGCATAT
TCGCCTTTCCGTCGACGCCCCGTCGGGCCATTCCACCCAGCCAACAAAGGCGCACTGATATGTGTGACCAGAGCC
GGCCAGATCAAGCTGATATATCAAAACCCCGACAGCAAATGGGCCGAGCTGCCAGCCGAACTGAAGAACACAGGG
TACTCGGATAGACTATTAACGCATGCATCCATGACCGCAACACAAGCTGGGATCCTTCTCTCCACCTACTCCGCA
TGCCAGAAAATGTGTCTTTATAGAGTGCACATCAGCTGGAACCCGCCACAATGGGAGCCGGCACAGGGAAAACTG
CCTGGCCAATTCCCTATCCCCACCTTCCGTTTGATCCACTGTAAAGTCGACATGCCTAACAATATATTGAACGTT
AACCGGGGCCCGGACCATCACGATCAGTCTTTGCCGTTTTTGAACTCGGTATACTCGTTGACACGACTAGAGATC
ATGCCGGGACAGTTTGATAGCCTCGCGGGGTCCACTGCTAACCCTTGGATCCTGGCTGTCTTATCGAAGCCTCTC
CACGCCATGCATGATTATCCAGACCAGCAAGGCCCACCGAGTGTGATTGTCAGGTGGCATTTGGAATCTGCCCCG
CAGATCCTCCATCCCAAGTTTGACGAAGTGACGTCAAAAAAGAGCAACGCTCAAGCAAAGCCCAAAATGGAACTG
CGGAGGCTGGAGAATGTTTATTGCGATAAGTACATTGTCTCGGTCGATTTAGTAGAGCATGGGACAGTCTTGGCT
GTCAGTCATGATGACAGCTCAATAACTTGCTACGACACACGGACAATGGCCGTTCTGAACGGTCTTGACGATTCA
AGCGCAGTGACCTGTCTGGCCCAGGCTGGGTTCCAGTACCCGCTCGAAACATCAGGTCTTCACATTGCTTTCTCT
CCTAATGCTTGCGTTGCCGTCACGCTGGATAGTGACGGACATATGCAACTGAGGGCGATGGAGCATTCATTTGGA
TCCACGGAGGGTCTCTATGACGAGAACAATCTTTCCGCGGCCATTGCGGCTTTGACATTGGCATTCAGTCGAGGA
TGTGGCGTTGATTATAATACAGATGACATACTCATGGTTGCTCTTGGGCAGCTATCACTAGAGGCTCAAACCACA
TTCATCAGCGAGGTGTACCGTGCACTGCCAGTCAATTGCAACTTTACAGCCGAACAGGACAAACTCATGAGCCAT
CCGTACATACCTCGTTGTCTCAGCTTACAGGCCGGACTGGGCTTCAAAGGGAGACTCAAGCGCCGCAACCTCTCA
TCGGCCGTGCCATGGGCAAGCCTTCAACTCAGACATGCCTCAGTTCTATTCGCATATTTCTTCCAGTATAATAAG
GGAGGCCAGACAGAATCGCATGATCCAGACGTTCTACGCATGGTATTGGGTAACACCAAATGGACACTAGACTTC
TCTCATTTTCTTCTGAGCGAAATCTTCGACATGGCCGACGAATTCGAAGATGTATTCGATGATTCAGAAGCATTC
ACACAGAAGTTGAAAAACTCTTCCTCTCTCCCCCTCCTAATCCTCCTCTCAAGCATGTCGCGCGCCTTCCTCCGC
TTCATCTGCCGTGGCCTCCGCGGCGTGCACGCTGGTTTCGCTAGCGCAAACCCCGCCTCTCTTCTAGGCGACTCC
CGAATCTACTACACAGAGATCTGCCAAACACTAGAATCATCGCCGGTACGAATCGACGTGTATGAGAAGTTCCTG
GCAGGAGTGGACTCAGCCGTGAAGCACGCCTACCAAGGCGCTGGCTTCGGCGATGCCGAAAGACCCGGCCCGGAA
AAGGAATTGCTGGTTAATGCGCGCATCCCGCCAGTCCTCACTACTGCCGTGGCCACCCTCCTCCGACAGACAGTC
CCGGCGCTCAAATCCGAGATCAACCGCATGGCGATCTACCTCGGGGACTATAGCTGGCTTGGTTTTGGAAATGAC
CGACGCACGGCGCTGTACCGGAGGCACCGTGAGGTCGATATCCTCAAGAAGTGCCCGCTGCGCCCGCCGTTGCCG
TTGGGGAATGATGGTCGCGTGGCGCCGGTAAAGAAACGCCGGTGTGCGCGTTGCTGTGAAGTCTCTGGTGATACG
AATCTGCCCCGGTCGCTTCTGTCGTTCAAGATGATTGCTAAGCTGGGGCTGTTGCGGTCTTGTCTTTGCGGGGGC
ATGTGGGTTCTTGAGACAGATACTGGGGTTCTGGGGATTGGTACTGCGAGTGCAAATGGCAATGGCAACCGGATT
ACCTAG
Gene >Pro_DTO377G3_2|g8626.t1
ATGGAGGACGGTATCGATGTGGATGATCTCTTTGGAGAACCCAACTCCCTGGAGCTGGGCTTGCCGACCGCCTCC
CCAATCAAAGGTCTAGCACAATGCTTAGATGAAATGCGTCTATCAGGGTGCTGCCAGTAAGCTTGGAAAAATGTT
GCACATCCAAATTCCAGCACTAACCATCTGCTAGGAAAATCGCCTGGTCTCGGATGGGATGTATTGCATCTATTT
CCCCAGACGGAATCCGGGTTATTATCCGCTATCTCCAATGCCGCCCATCAGATGGCAAATGGGTGCTCGGGGAAG
AGTCATCTTTGGCTCCAGTCTTGGAGGCCCATAATGGCACTCAACTGGCCCATCTATCATGGAATGAAACAGGCT
CAGAACTGGCCGTTGTCGACTGTTCCGGTCGGGTATCAATCTATTCCATTTCAATTGCACTGAACAGCATCACAG
GCTTGCGTCAAGCCTCATTTGACTCCGGCGATGATGGCAGCCAGGTTGTTGGGATGATGTGGCTGAACTCCCAGC
GTTATGTACGTTGAGTCCCCTTGTATTATCCATCGATATATCAAGATAAGAGTGAAAGGACTCTAACTGGTAATA
TAGGTGCATGCATTTCATCAAGCAGCCAAGGTGAATGGCCGATGGGCATATTCGCCTTTCCGTCGACGCCCCGTC
GGGCCATTCCACCCAGCCAACAAAGGCGCACTGATATGTGTGACCAGAGCCGGCCAGATCAAGCTGATATATCAA
AACCCCGACAGCAAATGGGCCGAGCTGCCAGCCGAACTGAAGAACACAGGGTACTCGGATAGACTATTAACGCAT
GCATCCATGACCGCAACACAAGGTATTGTCTTTCAGTCGGAGCTCCATTTCCTGCCATCACTGACACATCAAAAC
AGCTGGGATCCTTCTCTCCACCTACTCCGCATGCCAGAAAATGTGTCTTTATAGAGTGCACATCAGCTGGAACCC
GCCACAATGGGAGCCGGCACAGGGAAAACTGCCTGGCCAATTCCCTATCCCCACCTTCCGTTTGATCCACTGTAA
AGTCGACATGCCTAACAATATATTGAACGTTAACCGGGGCCCGGACCATCACGATCAGTCTTTGCCGTTTTTGAA
CTCGGTATACTCGTTGACACGACTAGAGATCATGCCGGGACAGTTTGATAGCCTCGCGGGGTCCACTGCTAACCC
TTGGATCCTGGCTGTCTTATCGAAGCCTCTCCACGCCATGCATGATTATCCAGACCAGCAAGGCCCACCGAGTGT
GATTGTCAGGTGGCATTTGGAATCTGCCCCGCAGATCCTCCATCCCAAGTTTGACGAAGTGACGTCAAAAAAGAG
CAACGCTCAAGCAAAGGTGTGCATTCCTCGATATTTGACTGTTGCGTGGAATCGATACTGACCTATCCTCAGCCC
AAAATGGAACTGCGGAGGCTGGAGAATGTTTATTGCGATAAGTACATTGTCTCGGTCGATTTAGTAGAGCATGGG
ACAGTCTTGGCTGTCAGTCATGATGACAGCTCAATAACTTGCTACGACACACGGACAATGGCCGTTCTGAACGGT
CTTGACGATTCAAGCGCAGTGACCTGTCTGGCCCAGGCTGGGTTCCAGTACCCGCTCGAAACATCAGGTACGAAA
CTAAACGATAGTGGCGTGGCTAGAACTGACATGGACAGGTCTTCACATTGCTTTCTCTCCTAATGCTTGCGTTGC
CGTCACGCTGGATAGTGACGGACATATGCAACTGAGGGCGATGGAGCATTCATTTGGATCCACGGAGGGTCTCTA
TGACGAGAGTATGTATCTTCCAGATGGCCTATCAGGTCACTTTTATGAAATAAAAATACTGACCGAGGCATGCAG
ACAATCTTTCCGCGGCCATTGCGGCTTTGACATTGGCATTCAGTCGAGGATGTGGCGTTGATTATAATACAGATG
ACATACTCATGGTTGCTCTTGGGCAGCTATCACTAGGTGAGTGCTTTGAAAACCTTCGTATTGATAATATCAAAT
CCACTGACAACTCCCAAAGAGGCTCAAACCACATTCATCAGCGAGGTGTACCGTGCACTGCCAGTCAATTGCAAC
TTTACAGCCGAACAGGACAAACTCATGAGCCATCCGTACATACCTCGTTGTCTCAGCTTACAGGCCGGACTGGGC
TTCAAAGGGAGACTCAAGCGCCGCAACCTCTCATCGGCCGTGCCATGGGCAAGCCTTCAACTCAGACATGCCTCA
GTTCTATTCGCATATTTCTTCCAGTATAATAAGGGAGGCCAGACAGAATCGCATGATCCAGGTGAGTTCAAAGAA
AGCCCATTTTATCGTTATCCGTTGCTAATTGAAACAAAAGACGTTCTACGCATGGTATTGGGTAACACCAAATGG
ACACTAGACTTCTCTCATTTTCTTCTGAGCGAAATCTTCGACATGGCCGACGAATTCGAAGATGTATTCGATGAT
TCAGAAGCATTCACACAGAAGTGTAAGGAACCTCTTAATAACCAACTCCAGCTTCGCTCACCCTTTTACAGTGAA
AAACTCTTCCTCTCTCCCCCTCCTAATCCTCCTCTCAAGCATGTCGCGCGCCTTCCTCCGCTTCATCTGCCGTGG
CCTCCGCGGCGTGCACGCTGGTTTCGCTAGCGCAAACCCCGCCTCTCTTCTAGGCGACTCCCGAATCTACTACAC
AGAGATCTGCCAAACACTAGAATCATCGCCGGTACGAATCGACGTGTATGAGAAGTTCCTGGCAGGAGTGGACTC
AGCCGTGAAGCACGCCTACCAAGGCGCTGGCTTCGGCGATGCCGAAAGACCCGGCCCGGAAAAGGAATTGCTGGT
TAATGCGCGCATCCCGCCAGTCCTCACTACTGCCGTGGCCACCCTCCTCCGACAGACAGTCCCGGCGCTCAAATC
CGAGATCAACCGCATGGCGATCTACCTCGGGGACTATAGCTGGCTTGGTTTTGGAAATGACCGACGCACGGCGCT
GTACCGGAGGCACCGTGAGGTCGATATCCTCAAGAAGTGCCCGCTGCGCCCGCCGTTGCCGTTGGGGAATGATGG
TCGCGTGGCGCCGGTAAAGAAACGCCGGTGTGCGCGTTGCTGTGAAGTCTCTGGTGATACGAATCTGCCCCGGTC
GCTTCTGTCGTTCAAGATGATTGCTAAGCTGGGGCTGTTGCGGTCTTGTCTTTGCGGGGGCATGTGGGTTCTTGA
GACAGATACTGGGGTTCTGGGGATTGGTACTGCGAGTGCAAATGGCAATGGCAACCGGATTACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail