Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8624.t1
Gene name
Locationscaffold_35:104720..105521
Strand-
Gene length (bp)801
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 1.2E-11 140 202

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 209 226 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 63.02 32.96 93.08
5d_25C Five days - 25 degrees Celsius 82.86 46.03 119.70
7d_25C Seven days - 25 degrees Celsius 84.05 46.54 121.55
10d_25C Ten days - 25 degrees Celsius 109.52 63.82 155.22
7d_15C Seven days - 15 degrees Celsius 72.85 39.39 106.32
7d_30C Seven days - 30 degrees Celsius 87.88 49.39 126.37

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.329678 no
3d_25C 7d_25C 0.297569 no
3d_25C 7d_15C 0.657598 no
3d_25C 7d_30C 0.210210 no
3d_25C 10d_25C 0.020140 yes
5d_25C 7d_25C 0.972956 no
5d_25C 7d_15C 0.697243 no
5d_25C 7d_30C 0.872372 no
5d_25C 10d_25C 0.277685 no
7d_25C 7d_15C 0.656426 no
7d_25C 7d_30C 0.905056 no
7d_25C 10d_25C 0.312771 no
7d_15C 7d_30C 0.528858 no
7d_15C 10d_25C 0.093253 no
7d_30C 10d_25C 0.413501 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8624.t1
MASSTSSGWTQLRQQARSLETQTENLFHTYSQFASITKPPPSPTEEELRLESQLKDLLERREAVIAQLSRLLDSE
ATLTASALKQNNVSRHREILQDHRRELQRLTAAISESRDRANLLSNVRSDISSYRASNPAAAEAEYMLEERGRVE
NSHSMMDGVLSQAYAINENFGVQSETIANINRRIVGAAGSVPGMNYLIGKIGNKKRRDAIILGCFIGFCFLMLLF
FR*
Coding >Pro_DTO377G3_2|g8624.t1
ATGGCATCCTCAACTAGCTCAGGTTGGACACAGCTCCGGCAACAAGCACGGTCGCTTGAAACTCAGACCGAGAAC
CTTTTCCACACCTATTCACAATTTGCATCCATAACCAAACCTCCGCCGTCACCCACGGAGGAGGAGCTGCGGCTT
GAATCGCAATTGAAAGACCTCCTCGAAAGACGCGAGGCTGTTATCGCCCAACTATCCCGTCTACTCGACTCCGAA
GCCACCCTCACTGCCTCCGCCCTTAAACAGAACAATGTCTCCCGCCACCGCGAAATACTCCAAGACCACCGCCGC
GAGCTTCAACGTCTGACCGCAGCTATTTCTGAATCGCGTGACCGCGCAAACCTACTCTCTAACGTCCGTTCAGAC
ATCAGCTCCTATCGCGCATCCAACCCCGCCGCTGCCGAGGCCGAGTACATGCTTGAAGAGCGGGGCCGAGTCGAG
AACAGCCACAGTATGATGGACGGCGTGCTGAGCCAGGCGTATGCCATCAATGAGAACTTCGGTGTCCAGAGCGAG
ACTATTGCCAACATTAATCGGCGTATTGTCGGAGCTGCTGGCAGTGTCCCCGGTATGAACTATCTCATCGGCAAG
ATTGGAAACAAGAAGAGGCGGGATGCTATTATCCTCGGATGCTTCATTGGGTTCTGCTTTTTGATGTTGCTGTTC
TTCCGGTAA
Transcript >Pro_DTO377G3_2|g8624.t1
ATGGCATCCTCAACTAGCTCAGGTTGGACACAGCTCCGGCAACAAGCACGGTCGCTTGAAACTCAGACCGAGAAC
CTTTTCCACACCTATTCACAATTTGCATCCATAACCAAACCTCCGCCGTCACCCACGGAGGAGGAGCTGCGGCTT
GAATCGCAATTGAAAGACCTCCTCGAAAGACGCGAGGCTGTTATCGCCCAACTATCCCGTCTACTCGACTCCGAA
GCCACCCTCACTGCCTCCGCCCTTAAACAGAACAATGTCTCCCGCCACCGCGAAATACTCCAAGACCACCGCCGC
GAGCTTCAACGTCTGACCGCAGCTATTTCTGAATCGCGTGACCGCGCAAACCTACTCTCTAACGTCCGTTCAGAC
ATCAGCTCCTATCGCGCATCCAACCCCGCCGCTGCCGAGGCCGAGTACATGCTTGAAGAGCGGGGCCGAGTCGAG
AACAGCCACAGTATGATGGACGGCGTGCTGAGCCAGGCGTATGCCATCAATGAGAACTTCGGTGTCCAGAGCGAG
ACTATTGCCAACATTAATCGGCGTATTGTCGGAGCTGCTGGCAGTGTCCCCGGTATGAACTATCTCATCGGCAAG
ATTGGAAACAAGAAGAGGCGGGATGCTATTATCCTCGGATGCTTCATTGGGTTCTGCTTTTTGATGTTGCTGTTC
TTCCGGTAA
Gene >Pro_DTO377G3_2|g8624.t1
ATGGCATCCTCAACTAGCTCAGGTTGGACACAGCTCCGGCAACAAGCACGGTCGCTTGAAACTCAGGTACCAATA
TCTCCTCATCAGGAGCCCTATACGAATATTAACTGATGCAACGATAGACCGAGAACCTTTTCCACACCTATTCAC
AATTTGCATCCATAACCAAACCTCCGCCGTCACCCACGGAGGAGGAGCTGCGGCTTGAATCGCAATTGAAAGACC
TCCTCGAAAGAGTACGTCCATTCACCGACATGTAACAGAGAGAAAAGCACCGACAACTAATTGACCGTACAGCGC
GAGGCTGTTATCGCCCAACTATCCCGTCTACTCGACTCCGAAGCCACCCTCACTGCCTCCGCCCTTAAACAGAAC
AATGTCTCCCGCCACCGCGAAATACTCCAAGACCACCGCCGCGAGCTTCAACGTCTGACCGCAGCTATTTCTGAA
TCGCGTGACCGCGCAAACCTACTCTCTAACGTCCGTTCAGACATCAGCTCCTATCGCGCATCCAACCCCGCCGCT
GCCGAGGCCGAGTACATGCTTGAAGAGCGGGGCCGAGTCGAGAACAGCCACAGTATGATGGACGGCGTGCTGAGC
CAGGCGTATGCCATCAATGAGAACTTCGGTGTCCAGAGCGAGACTATTGCCAACATTAATCGGCGTATTGTCGGA
GCTGCTGGCAGTGTCCCCGGTATGAACTATCTCATCGGCAAGATTGGAAACAAGAAGAGGCGGGATGCTATTATC
CTCGGATGCTTCATTGGGTTCTGCTTTTTGATGTTGCTGTTCTTCCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail