Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8609.t1
Gene name
Locationscaffold_35:60429..61548
Strand+
Gene length (bp)1119
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 54.30 31.65 76.94
5d_25C Five days - 25 degrees Celsius 69.91 41.72 98.10
7d_25C Seven days - 25 degrees Celsius 76.17 45.67 106.68
10d_25C Ten days - 25 degrees Celsius 93.15 56.73 129.57
7d_15C Seven days - 15 degrees Celsius 62.99 37.05 88.93
7d_30C Seven days - 30 degrees Celsius 72.58 43.34 101.82

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.304669 no
3d_25C 7d_25C 0.149400 no
3d_25C 7d_15C 0.597680 no
3d_25C 7d_30C 0.224264 no
3d_25C 10d_25C 0.007779 yes
5d_25C 7d_25C 0.780378 no
5d_25C 7d_15C 0.723513 no
5d_25C 7d_30C 0.912283 no
5d_25C 10d_25C 0.214011 no
7d_25C 7d_15C 0.461666 no
7d_25C 7d_30C 0.883812 no
7d_25C 10d_25C 0.425141 no
7d_15C 7d_30C 0.607826 no
7d_15C 10d_25C 0.071215 no
7d_30C 10d_25C 0.295000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8609.t1
MHSSRLRKRHAERLETIQDLVPSLPAAPLTSPLFTVFPAEIRNRVYTFALESEDVLTDDSSHSLYKQNAFYYRPG
YKQPKRIQTALLQTCQQIYAEASLLPPAVNEHTFWFYRSPPHVNDASSPLNYFRKMTPKQRAQVQHLHLFTQQYF
LEDNHWSQIWEGLKIGDDGRSLRGECRIAPKKMTITFRHTDWWYWENNDPLGIDPFRPGRTHATDMGKAVSPHDA
ARSWGNQFSSIPCLEELVIEFETIMRKRDQLDDIIQQALEWKFPMEADKGLYLVADPKSKSAYTWAGAKEAELKR
QRPVRPVDAEAESESAHEQEPVPAAPALVPYDPQSDSGTNSDINLGNHPPSDTDTEKFYVVFLTWRKQRVLE*
Coding >Pro_DTO377G3_2|g8609.t1
ATGCATTCAAGTCGACTAAGAAAACGCCATGCAGAGAGGTTGGAGACCATCCAGGACCTTGTCCCATCTCTACCT
GCAGCCCCATTGACATCCCCGCTATTTACCGTCTTCCCCGCCGAGATCCGCAATCGCGTTTATACGTTCGCCCTT
GAGTCCGAGGATGTTCTCACAGACGACAGTTCTCACTCCCTCTACAAGCAAAATGCTTTCTACTACCGACCCGGT
TATAAGCAGCCCAAGCGCATCCAAACTGCCCTCCTCCAGACATGTCAGCAAATCTACGCTGAGGCGTCCCTCCTC
CCACCGGCTGTAAATGAGCATACTTTCTGGTTTTATCGGTCTCCGCCGCATGTCAATGATGCGTCGTCACCGCTA
AATTACTTTCGCAAGATGACCCCAAAACAGCGGGCTCAGGTGCAGCATCTGCACCTGTTCACCCAACAGTATTTC
CTAGAGGACAACCATTGGTCTCAGATATGGGAGGGGTTGAAGATAGGCGACGACGGGCGCAGTTTGCGAGGGGAG
TGCCGGATCGCCCCGAAGAAGATGACCATCACCTTTCGCCACACGGACTGGTGGTACTGGGAGAACAATGACCCC
CTGGGCATCGATCCGTTCCGGCCCGGAAGAACACATGCAACCGATATGGGCAAGGCTGTTTCCCCGCACGACGCC
GCTCGATCATGGGGGAACCAATTCAGCTCTATCCCCTGCCTTGAAGAATTGGTGATCGAGTTCGAGACCATCATG
CGGAAGAGGGACCAGCTAGATGACATCATACAACAAGCTCTCGAGTGGAAATTTCCCATGGAGGCTGACAAGGGC
TTATATCTGGTGGCTGACCCCAAGTCGAAGAGCGCATATACTTGGGCTGGGGCGAAAGAGGCGGAGCTGAAAAGA
CAGAGACCTGTACGACCGGTCGATGCTGAGGCTGAGTCAGAATCTGCCCACGAACAGGAGCCGGTTCCTGCAGCT
CCGGCTTTGGTGCCGTATGATCCTCAGTCCGATTCAGGCACAAATAGCGACATTAATCTTGGAAACCATCCCCCA
TCTGACACAGATACGGAGAAGTTCTATGTCGTCTTCTTGACTTGGAGGAAACAGCGTGTCCTGGAGTGA
Transcript >Pro_DTO377G3_2|g8609.t1
ATGCATTCAAGTCGACTAAGAAAACGCCATGCAGAGAGGTTGGAGACCATCCAGGACCTTGTCCCATCTCTACCT
GCAGCCCCATTGACATCCCCGCTATTTACCGTCTTCCCCGCCGAGATCCGCAATCGCGTTTATACGTTCGCCCTT
GAGTCCGAGGATGTTCTCACAGACGACAGTTCTCACTCCCTCTACAAGCAAAATGCTTTCTACTACCGACCCGGT
TATAAGCAGCCCAAGCGCATCCAAACTGCCCTCCTCCAGACATGTCAGCAAATCTACGCTGAGGCGTCCCTCCTC
CCACCGGCTGTAAATGAGCATACTTTCTGGTTTTATCGGTCTCCGCCGCATGTCAATGATGCGTCGTCACCGCTA
AATTACTTTCGCAAGATGACCCCAAAACAGCGGGCTCAGGTGCAGCATCTGCACCTGTTCACCCAACAGTATTTC
CTAGAGGACAACCATTGGTCTCAGATATGGGAGGGGTTGAAGATAGGCGACGACGGGCGCAGTTTGCGAGGGGAG
TGCCGGATCGCCCCGAAGAAGATGACCATCACCTTTCGCCACACGGACTGGTGGTACTGGGAGAACAATGACCCC
CTGGGCATCGATCCGTTCCGGCCCGGAAGAACACATGCAACCGATATGGGCAAGGCTGTTTCCCCGCACGACGCC
GCTCGATCATGGGGGAACCAATTCAGCTCTATCCCCTGCCTTGAAGAATTGGTGATCGAGTTCGAGACCATCATG
CGGAAGAGGGACCAGCTAGATGACATCATACAACAAGCTCTCGAGTGGAAATTTCCCATGGAGGCTGACAAGGGC
TTATATCTGGTGGCTGACCCCAAGTCGAAGAGCGCATATACTTGGGCTGGGGCGAAAGAGGCGGAGCTGAAAAGA
CAGAGACCTGTACGACCGGTCGATGCTGAGGCTGAGTCAGAATCTGCCCACGAACAGGAGCCGGTTCCTGCAGCT
CCGGCTTTGGTGCCGTATGATCCTCAGTCCGATTCAGGCACAAATAGCGACATTAATCTTGGAAACCATCCCCCA
TCTGACACAGATACGGAGAAGTTCTATGTCGTCTTCTTGACTTGGAGGAAACAGCGTGTCCTGGAGTGA
Gene >Pro_DTO377G3_2|g8609.t1
ATGCATTCAAGTCGACTAAGAAAACGCCATGCAGAGAGGTTGGAGACCATCCAGGACCTTGTCCCATCTCTACCT
GCAGCCCCATTGACATCCCCGCTATTTACCGTCTTCCCCGCCGAGATCCGCAATCGCGTTTATACGTTCGCCCTT
GAGTCCGAGGATGTTCTCACAGACGACAGTTCTCACTCCCTCTACAAGCAAAATGCTTTCTACTACCGACCCGGT
TATAAGCAGCCCAAGCGCATCCAAACTGCCCTCCTCCAGACATGTCAGCAAATCTACGCTGAGGCGTCCCTCCTC
CCACCGGCTGTAAATGAGCATACTTTCTGGTTTTATCGGTCTCCGCCGCATGTCAATGATGCGTCGTCACCGCTA
AATTACTTTCGCAAGATGACCCCAAAACAGCGGGCTCAGGTGCAGCATCTGCACCTGTTCACCCAACAGTATTTC
CTAGAGGACAACCATTGGTCTCAGATATGGGAGGGGTTGAAGATAGGCGACGACGGGCGCAGTTTGCGAGGGGAG
TGCCGGATCGCCCCGAAGAAGATGACCATCACCTTTCGCCACACGGACTGGTGGTACTGGGAGAACAATGACCCC
CTGGGCATCGATCCGTTCCGGCCCGGAAGAACACATGCAACCGATATGGGCAAGGCTGTTTCCCCGCACGACGCC
GCTCGATCATGGGGGAACCAATTCAGCTCTATCCCCTGCCTTGAAGAATTGGTGATCGAGTTCGAGACCATCATG
CGGAAGAGGGACCAGCTAGATGACATCATACAACAAGCTCTCGAGTGGAAATTTCCCATGGAGGCTGACAAGGGC
TTATATCTGGTGGCTGACCCCAAGTCGAAGAGCGCATATACTTGGGCTGGGGCGAAAGAGGCGGAGCTGAAAAGA
CAGAGACCTGTACGACCGGTCGATGCTGAGGCTGAGTCAGAATCTGCCCACGAACAGGAGCCGGTTCCTGCAGCT
CCGGCTTTGGTGCCGTATGATCCTCAGTCCGATTCAGGCACAAATAGCGACATTAATCTTGGAAACCATCCCCCA
TCTGACACAGATACGGAGAAGTTCTATGTCGTCTTCTTGACTTGGAGGAAACAGCGTGTCCTGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail