Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8606.t1
Gene name
Locationscaffold_35:45878..53340
Strand+
Gene length (bp)7462
Transcript length (bp)7032
Coding sequence length (bp)7032
Protein length (aa) 2344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 6.6E-75 2 252
PF08659 KR KR domain 7.5E-58 1978 2156
PF00698 Acyl_transf_1 Acyl transferase domain 1.7E-48 530 864
PF14765 PS-DH Polyketide synthase dehydratase 2.0E-46 920 1198
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.2E-36 261 378
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 2.2E-20 382 499
PF00106 adh_short short chain dehydrogenase 8.8E-13 1981 2139
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.6E-06 1989 2129
PF00550 PP-binding Phosphopantetheine attachment site 4.9E-06 2267 2323

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8606.t1
MEGIAVIGMGCRFSGGATSVENFWQMLCDGRTGHGTVPTSRYQASAWHHPSHERKGAINHDSGFFLQEDPSRFDA
PFFSITAKEAAGMDPAQRLLLEVAYETFENSGIPIDTLPGSNTAVYSGSMTNDYELLSTRDIYDMPHNSATGNGR
TMLANRLSWFFDLQGPSIMMDTACSSSLTAIHLAAQSLRSGECGMALVTGASLILHPNFTQRLSYMHMMSADGIS
HSFDESANGYGRGEGIGAVLLKPLSAALADGDNIRAVIRGTGINQDGRTPGITLPSPTSQANLIRSVYERHGISM
RDTSYFEAHGTGTPVGDPIELSAVGMTLGQARTPTDEPIYVGSVKTNFGHTEGAAGVASLIKVVLCLEKGTLVPN
AGFQNINPKIRLDDWRLRLSDKTMPWPDHLPQRASINSFGFGGSNAHLILESAKEALGNAKDQEPAPHVVVFSTF
DQAGIERTGQNWSTFLQRQQKAEREASLKDLAHTMLTRRSQLGFRSFAVANSQDQLQSILDKGLPKFPRASRKAQ
TRLAFVFTGQGGQWAGMGRELLRIPTFRESIARSQEILSSLGCPFDMVEEIKAEAKDSQINRPDRSQPITCALQI
ALVDLLASWSVFPNAVVGHSSGEIAAGYAAGYLSREDAMRVAWFRGFFSQQIAQSDRRGGMLATGISAADAKKYL
EELPARSVVVACVNSPASTTLSGDVEFIDQLEARLQQDGHFARKLRIDTAYHSPHMEDLVKVVGSAIDCIKPEDR
YNGSIPMLSSVTKERVYPAELGGSYWVRNMVSSVEFTAAVSQLANLSESIKSRRRPVPIKWTALIEIGPHAVLKG
PVTQILQSVNANMASLPYYSLVSRNQHALRTALEVAGSLWSTGHTIDLAAVNSSVDNTSPKMIPDLPSYPWNHQT
SFWHEPLETAQLRQRQHPRHDILGAAVDFQNALEPRWRNFLRLSENPWMADHVVAGSIVFPAAGMLVMATEAARQ
LADSPANIKGIEFQDLHFMRGVVIPDEERGLETLLQVSPHPGMPGWYQFGIFSLPSGGAWIQHAKGAFIARFENR
TDDEHNSNWQAALERIKNTQTVAKMADVGQAREWLSNTGGLTVGPAFQTVTGVSFCDSESRLWLSGVVTDTKQSM
PFEKESSSFIHPTTLDCLFQSALLSCSDALSSNKANIPIGVDNIYISNTFQPQPGEQFVVHTETKWRDGKSQSHC
IASDPTWSQPWITFEGVHLGRLPFNSNSLKQEEASSESRYSSIVWDEHLESPLVTSQINDGNKKKAVQASSLQLT
DWIKRLCYTNGDARALITTSDTSSWIASLQELIPSAGKRPCLGRMTVASCGHENQVEGVTPTENSLPGTHLASLT
TLSELPSSSLAQDKYDLVVIDEPKWDDKIIQVILSCLPTILEHGGLAAIRVSGTNRDSAAEKLQRLEGLEIHSTT
KDREFIIARRTPVSWTTDSEIYILSPADKSNTLAVFEHLGNIFATHNVRLVPVELEQVGTLAGKTVISLLDLASP
WISGWTENDLERLQELIRVKYVLWVSPSWSQGAVENIGSGATGGLLRTLRNEQWNTTIPHLLVDVEDLEDKFGLA
CGILQVMQLTTQESSRRPDLEYRLANGRLLVPRVIETPTVDEAMHTLMNGPRPVMSDLTLDPRRLELKFQDADNA
RWEEQQPFEEGLRTDHIEIMVEMATIFDLHGDQGKTPETALPMFEIVGKVTLIGSGVHDLAVGDKVLTLTSASSG
LMTAMRVLESDTIRIPANMDPKNAISTPLAYINAYQILTQVGRLSSSSSVLLVGSISQTLQAMIDYALAMNMQVI
VATDSADTTENLRSRYPVLADRILGVHGSLETSVSRLTNGCGVDASICFLGGYAGRNAARCLVPGGQYINLSSEM
KMSALPESFIDSGCTFSSPRLQKIFSEKPGNLHASVRHVVDFMKQHRMLDRVESYSMFPVSDLQGALKHCKVANT
RAIVDLRAPGRVPIVLPLPNLTGLPAEGTYILAGGLGNLGLALADTLVQSGARHLVFLGRSGGAQPGQQLALDLL
RSHGCRIDVLRCDIAQQADIDHLSYKIRSKNWTVAGVIQCTTVLKDAMFENMTFDDWTQSTQSKIRGTLNLHHLF
SEFEGLGFFIALSSVASVIGNMGQANYSAGNGFIDALMEWRRSHGLPGHSINIGLVPDASGLSDIAEDQEQRRRR
YKHLEGTEIMTHELQTLLRVIINSKLSLPSQIIAGMTDHLSRSNGSIAWVLDRKFDHRLCLAADDTEDSIQTSAL
LKGCDSLDNATEVVLNALSEYLADAMATTADAIDSDLPLSALGVDSLKATAVQNWVSRELGSELSSFEFLGSQPT
KALARKIASTSSFVSVPS*
Coding >Pro_DTO377G3_2|g8606.t1
ATGGAGGGAATTGCAGTCATTGGAATGGGGTGTCGCTTCTCTGGAGGAGCGACCTCCGTTGAGAACTTCTGGCAG
ATGCTATGCGACGGACGTACTGGGCATGGGACAGTTCCCACAAGCCGATACCAAGCTTCGGCCTGGCATCACCCT
AGCCATGAACGCAAAGGAGCGATCAATCATGATAGTGGGTTTTTCTTGCAGGAAGATCCATCACGGTTTGACGCT
CCTTTTTTCTCTATCACTGCCAAAGAGGCGGCGGGCATGGACCCAGCACAACGTTTGTTGCTCGAAGTTGCATAC
GAAACATTCGAAAACAGCGGGATACCGATAGACACGCTTCCAGGCAGTAACACGGCAGTGTACTCTGGTTCAATG
ACCAATGACTATGAGCTATTGTCAACAAGAGATATCTATGATATGCCTCACAACTCGGCTACTGGTAATGGAAGG
ACTATGCTGGCAAATCGGTTGTCATGGTTCTTTGATCTTCAAGGCCCAAGTATCATGATGGATACTGCGTGTTCT
TCAAGTTTGACTGCGATCCACCTAGCAGCTCAATCCTTGCGGTCTGGAGAGTGCGGAATGGCCTTGGTGACTGGT
GCCAGTCTTATCTTGCACCCTAATTTTACACAAAGACTGTCCTACATGCACATGATGAGTGCAGATGGCATAAGT
CATTCATTTGATGAGTCTGCAAATGGATATGGTCGGGGTGAGGGCATCGGTGCTGTGCTTTTGAAGCCCCTCAGC
GCCGCATTAGCCGATGGAGATAATATTCGAGCCGTCATCCGCGGCACAGGAATTAATCAGGATGGCCGGACTCCT
GGGATTACACTGCCCAGTCCAACGTCCCAAGCCAACTTGATTCGTTCGGTTTATGAACGTCATGGCATCTCAATG
AGAGACACTTCCTACTTTGAAGCACATGGCACTGGAACTCCTGTCGGGGATCCCATAGAGCTGTCTGCTGTCGGA
ATGACTTTGGGCCAGGCACGAACACCGACTGATGAGCCAATATACGTAGGCTCAGTGAAGACAAATTTCGGTCAC
ACCGAAGGAGCCGCAGGAGTGGCTAGCTTGATCAAAGTCGTGCTGTGTTTAGAAAAGGGCACATTGGTGCCAAAC
GCCGGGTTCCAAAACATCAATCCCAAGATCCGGCTCGATGATTGGCGTTTACGCCTAAGCGACAAAACAATGCCC
TGGCCAGACCATCTTCCGCAGCGGGCTAGTATCAACTCATTTGGATTCGGTGGATCAAATGCGCATTTGATTCTC
GAAAGTGCCAAAGAAGCCCTGGGCAATGCTAAAGACCAGGAGCCGGCCCCTCATGTGGTGGTGTTTTCTACATTT
GACCAAGCTGGTATCGAACGGACCGGTCAAAATTGGAGCACATTTCTTCAACGTCAACAAAAAGCCGAGCGGGAG
GCTTCACTCAAAGATTTAGCCCATACGATGTTGACACGCCGATCGCAGTTAGGCTTCCGTAGCTTCGCAGTTGCT
AACTCACAAGACCAGCTGCAGAGCATCTTGGATAAAGGATTGCCCAAATTTCCCCGAGCTAGTCGCAAAGCTCAA
ACAAGACTTGCTTTTGTGTTCACGGGTCAGGGTGGCCAATGGGCTGGAATGGGCCGGGAGCTTTTGAGGATTCCC
ACTTTCAGGGAAAGTATAGCACGATCACAGGAAATTCTTTCGTCCCTGGGATGTCCCTTTGATATGGTGGAGGAG
ATAAAGGCGGAGGCAAAAGACAGTCAGATAAACCGACCTGATCGCAGCCAGCCTATCACCTGCGCATTGCAGATT
GCTTTGGTTGATCTTCTGGCCAGTTGGTCGGTTTTTCCCAACGCAGTGGTTGGCCACTCCAGCGGTGAAATTGCT
GCTGGATATGCCGCTGGGTATCTTTCTCGTGAAGACGCTATGCGAGTCGCATGGTTCCGCGGTTTCTTTTCGCAG
CAGATTGCCCAGAGTGACAGACGAGGTGGTATGCTCGCTACTGGTATTTCTGCGGCTGACGCAAAGAAGTACCTC
GAGGAGCTGCCTGCACGTTCAGTTGTGGTTGCCTGTGTCAATAGTCCTGCCAGTACAACCCTCTCGGGTGATGTG
GAATTCATTGATCAGCTTGAAGCAAGATTACAACAGGATGGTCACTTTGCCCGGAAGCTGCGCATTGATACAGCT
TATCATTCCCCTCACATGGAAGATCTAGTTAAAGTGGTAGGTAGTGCTATCGATTGTATCAAGCCTGAGGATCGA
TACAATGGCTCAATTCCCATGCTTTCATCGGTCACAAAAGAGCGTGTCTATCCCGCCGAACTTGGTGGATCATAC
TGGGTACGCAACATGGTCAGCTCGGTTGAGTTTACTGCCGCAGTGTCACAACTCGCAAACCTGAGCGAGTCTATC
AAGTCTCGCCGACGGCCGGTTCCAATAAAATGGACCGCTTTGATTGAAATCGGTCCACACGCCGTTTTAAAAGGA
CCTGTCACTCAAATCCTGCAGTCTGTCAACGCAAATATGGCATCATTGCCGTACTATTCGTTGGTTTCACGGAAC
CAGCATGCTTTGCGAACAGCATTGGAAGTTGCTGGCTCGCTTTGGAGCACAGGACACACAATAGACCTTGCTGCG
GTCAACAGCAGTGTCGATAATACAAGCCCAAAAATGATTCCAGATTTGCCTTCTTATCCTTGGAATCACCAAACG
TCCTTCTGGCACGAGCCATTAGAGACAGCGCAGTTGAGACAACGTCAGCATCCACGTCATGATATTCTGGGAGCT
GCCGTAGATTTTCAAAACGCTTTAGAGCCAAGATGGAGAAACTTCCTGCGACTCTCCGAGAATCCATGGATGGCC
GATCATGTTGTCGCCGGATCGATTGTGTTCCCAGCCGCGGGAATGTTGGTGATGGCTACTGAGGCGGCGCGGCAA
CTAGCTGATAGCCCAGCCAACATCAAAGGAATAGAATTCCAAGACCTTCATTTTATGCGAGGGGTTGTTATCCCA
GACGAGGAACGCGGCTTGGAAACTCTTCTTCAGGTCTCCCCTCATCCAGGGATGCCGGGTTGGTATCAGTTCGGA
ATTTTCTCACTTCCCTCGGGGGGTGCTTGGATTCAACACGCGAAGGGTGCATTCATTGCGCGATTCGAGAACCGA
ACCGACGATGAGCATAATTCAAACTGGCAAGCAGCGTTGGAACGCATCAAGAATACCCAAACAGTCGCCAAAATG
GCTGACGTTGGACAAGCACGTGAATGGTTGTCTAACACAGGAGGACTCACCGTAGGACCGGCCTTCCAGACAGTC
ACTGGCGTTTCTTTTTGCGATTCAGAGTCTCGTCTCTGGCTATCCGGGGTCGTCACAGACACAAAACAATCAATG
CCTTTCGAAAAGGAGTCATCCAGTTTTATCCATCCCACAACTCTTGATTGCCTCTTCCAGTCTGCCCTGTTGTCC
TGCTCTGATGCATTATCCAGCAACAAAGCAAATATTCCGATCGGAGTGGACAATATCTACATATCCAATACGTTC
CAACCCCAACCGGGGGAGCAGTTTGTCGTCCACACAGAGACCAAGTGGCGAGACGGGAAATCACAATCCCACTGT
ATCGCGTCGGACCCCACCTGGTCACAACCCTGGATCACGTTTGAAGGTGTTCATCTCGGTCGCCTTCCCTTCAAC
TCAAATTCTCTAAAGCAAGAGGAAGCATCTTCGGAGAGCCGATATTCGTCGATTGTTTGGGATGAACACTTGGAG
TCGCCGCTTGTCACTAGCCAAATCAATGACGGAAACAAGAAGAAGGCCGTGCAAGCCAGCAGTCTCCAACTAACA
GACTGGATCAAGAGATTGTGCTATACCAACGGGGATGCCAGAGCACTCATTACTACTTCGGACACATCCTCTTGG
ATCGCAAGTCTACAAGAGCTGATTCCAAGTGCCGGCAAGCGGCCGTGCCTAGGAAGGATGACAGTCGCTTCATGT
GGCCACGAAAATCAAGTGGAGGGCGTCACTCCCACAGAGAACAGCCTCCCGGGAACTCACCTGGCATCCCTCACT
ACATTAAGCGAACTTCCATCTTCGTCGCTCGCTCAGGATAAATATGATTTGGTCGTGATCGATGAGCCCAAGTGG
GACGACAAAATCATTCAAGTTATCCTATCGTGTCTGCCCACCATTCTTGAACACGGAGGTTTAGCAGCAATACGG
GTATCAGGAACCAATCGAGACTCGGCAGCAGAGAAGTTGCAACGATTGGAAGGCCTTGAAATTCACAGCACGACC
AAAGATCGCGAGTTTATCATCGCGCGCAGAACACCAGTCTCGTGGACTACAGACTCCGAAATCTATATTTTGAGT
CCAGCCGACAAATCTAACACACTAGCTGTTTTCGAGCACCTTGGGAATATATTTGCCACCCATAACGTTCGTCTG
GTGCCTGTTGAATTGGAACAGGTGGGTACACTAGCAGGAAAGACTGTGATTTCTTTGCTTGACTTGGCAAGTCCC
TGGATATCCGGCTGGACGGAAAATGATTTGGAACGTCTCCAGGAGTTGATCCGAGTTAAATACGTTCTTTGGGTG
TCCCCTTCCTGGAGCCAAGGGGCTGTTGAGAATATTGGATCTGGTGCCACAGGCGGCCTTTTGCGAACACTTCGC
AATGAGCAGTGGAACACCACCATCCCACACCTATTGGTCGATGTGGAAGATTTGGAAGACAAGTTCGGACTAGCT
TGTGGCATTCTCCAAGTCATGCAGCTCACGACGCAGGAGAGCTCGCGCCGGCCAGACTTGGAGTATCGTCTGGCA
AACGGTCGGCTGCTAGTTCCACGGGTCATTGAGACTCCAACAGTGGATGAGGCCATGCACACTCTTATGAATGGC
CCCAGGCCTGTGATGTCAGACCTTACACTTGATCCGAGACGCCTTGAGTTGAAGTTCCAAGATGCAGACAACGCA
CGCTGGGAGGAACAACAACCATTCGAAGAGGGACTTCGCACTGACCACATTGAAATCATGGTTGAAATGGCCACA
ATCTTCGATTTACATGGGGATCAAGGGAAGACACCAGAGACAGCTCTTCCAATGTTCGAAATTGTTGGAAAGGTA
ACTCTTATCGGATCTGGTGTGCACGACTTGGCTGTTGGCGATAAAGTGTTAACCCTAACATCGGCGAGCTCGGGA
CTCATGACAGCAATGCGGGTCTTAGAAAGTGACACTATCAGGATTCCTGCAAATATGGACCCAAAAAATGCGATA
TCAACTCCTCTAGCGTACATAAACGCTTATCAGATTCTCACCCAAGTTGGTCGCCTCAGTTCAAGTTCCTCGGTG
CTTTTGGTCGGCTCAATCAGTCAAACTCTCCAGGCCATGATAGATTATGCCCTTGCCATGAACATGCAAGTCATC
GTGGCAACTGATTCTGCAGATACCACCGAGAACCTTCGTTCTCGCTACCCAGTATTAGCGGATCGAATTCTCGGC
GTTCACGGTAGCCTAGAAACAAGTGTGTCTAGGCTAACCAACGGATGTGGAGTTGACGCCAGCATTTGCTTCCTT
GGCGGCTATGCGGGTCGGAATGCTGCTAGGTGTCTTGTCCCAGGTGGACAGTACATTAATCTATCTAGCGAGATG
AAGATGAGTGCTCTTCCAGAGAGCTTCATTGACAGTGGCTGCACATTCTCTTCGCCGCGACTGCAGAAAATTTTC
TCGGAGAAACCCGGCAATCTTCATGCTTCAGTACGGCATGTGGTTGACTTCATGAAGCAGCATAGGATGTTGGAC
CGCGTGGAGTCCTATTCTATGTTCCCCGTTTCTGATCTCCAAGGAGCTTTGAAACATTGCAAAGTGGCCAATACC
CGAGCTATCGTGGATCTTCGGGCTCCTGGAAGGGTCCCTATTGTTCTGCCACTGCCAAATCTTACTGGCTTGCCA
GCGGAAGGCACATATATACTAGCAGGTGGATTAGGAAACCTCGGCCTTGCGCTTGCCGATACCTTGGTGCAGTCC
GGGGCCCGCCATTTGGTTTTCCTTGGAAGATCTGGCGGGGCACAACCTGGTCAACAGCTAGCCCTTGATCTCCTT
CGCTCTCATGGGTGCCGCATAGATGTACTGCGCTGTGATATCGCCCAACAGGCAGATATTGACCACCTGTCATAC
AAGATTCGGAGTAAGAACTGGACCGTTGCAGGCGTGATTCAGTGTACAACAGTTCTGAAGGACGCAATGTTCGAG
AACATGACTTTTGATGATTGGACCCAATCCACACAGTCCAAGATCCGCGGGACACTGAACTTGCACCATCTATTT
TCGGAATTTGAAGGCTTGGGTTTCTTCATTGCTTTGTCTTCCGTGGCCAGTGTCATTGGTAATATGGGACAGGCT
AACTATTCTGCGGGCAATGGTTTCATTGACGCTCTCATGGAATGGCGACGCAGTCACGGTCTCCCAGGTCATTCT
ATCAATATTGGCCTCGTTCCAGATGCTAGTGGACTCAGCGACATTGCCGAAGATCAAGAGCAACGCCGCCGCCGA
TACAAACATCTTGAGGGTACAGAAATCATGACCCATGAGCTCCAGACCTTGCTCAGAGTGATCATTAACAGCAAG
CTTTCTCTTCCATCTCAAATAATTGCTGGCATGACCGATCATCTGTCTCGCAGCAATGGCTCCATAGCCTGGGTT
CTCGATCGAAAGTTTGATCACCGGCTTTGCCTTGCTGCCGATGACACTGAGGACTCTATTCAGACTAGCGCCTTA
CTCAAGGGGTGTGACTCCCTTGACAATGCAACTGAGGTTGTCCTTAACGCTCTGAGTGAATATCTAGCAGATGCA
ATGGCTACAACTGCCGATGCTATCGACTCAGATCTACCATTGTCCGCGTTGGGAGTTGATTCCCTGAAAGCTACA
GCCGTTCAAAACTGGGTCTCTCGCGAACTGGGGTCAGAACTATCCTCCTTCGAGTTTCTTGGCTCACAACCGACC
AAGGCGTTAGCGAGGAAAATTGCTTCTACTAGTTCGTTTGTCTCGGTGCCGAGCTGA
Transcript >Pro_DTO377G3_2|g8606.t1
ATGGAGGGAATTGCAGTCATTGGAATGGGGTGTCGCTTCTCTGGAGGAGCGACCTCCGTTGAGAACTTCTGGCAG
ATGCTATGCGACGGACGTACTGGGCATGGGACAGTTCCCACAAGCCGATACCAAGCTTCGGCCTGGCATCACCCT
AGCCATGAACGCAAAGGAGCGATCAATCATGATAGTGGGTTTTTCTTGCAGGAAGATCCATCACGGTTTGACGCT
CCTTTTTTCTCTATCACTGCCAAAGAGGCGGCGGGCATGGACCCAGCACAACGTTTGTTGCTCGAAGTTGCATAC
GAAACATTCGAAAACAGCGGGATACCGATAGACACGCTTCCAGGCAGTAACACGGCAGTGTACTCTGGTTCAATG
ACCAATGACTATGAGCTATTGTCAACAAGAGATATCTATGATATGCCTCACAACTCGGCTACTGGTAATGGAAGG
ACTATGCTGGCAAATCGGTTGTCATGGTTCTTTGATCTTCAAGGCCCAAGTATCATGATGGATACTGCGTGTTCT
TCAAGTTTGACTGCGATCCACCTAGCAGCTCAATCCTTGCGGTCTGGAGAGTGCGGAATGGCCTTGGTGACTGGT
GCCAGTCTTATCTTGCACCCTAATTTTACACAAAGACTGTCCTACATGCACATGATGAGTGCAGATGGCATAAGT
CATTCATTTGATGAGTCTGCAAATGGATATGGTCGGGGTGAGGGCATCGGTGCTGTGCTTTTGAAGCCCCTCAGC
GCCGCATTAGCCGATGGAGATAATATTCGAGCCGTCATCCGCGGCACAGGAATTAATCAGGATGGCCGGACTCCT
GGGATTACACTGCCCAGTCCAACGTCCCAAGCCAACTTGATTCGTTCGGTTTATGAACGTCATGGCATCTCAATG
AGAGACACTTCCTACTTTGAAGCACATGGCACTGGAACTCCTGTCGGGGATCCCATAGAGCTGTCTGCTGTCGGA
ATGACTTTGGGCCAGGCACGAACACCGACTGATGAGCCAATATACGTAGGCTCAGTGAAGACAAATTTCGGTCAC
ACCGAAGGAGCCGCAGGAGTGGCTAGCTTGATCAAAGTCGTGCTGTGTTTAGAAAAGGGCACATTGGTGCCAAAC
GCCGGGTTCCAAAACATCAATCCCAAGATCCGGCTCGATGATTGGCGTTTACGCCTAAGCGACAAAACAATGCCC
TGGCCAGACCATCTTCCGCAGCGGGCTAGTATCAACTCATTTGGATTCGGTGGATCAAATGCGCATTTGATTCTC
GAAAGTGCCAAAGAAGCCCTGGGCAATGCTAAAGACCAGGAGCCGGCCCCTCATGTGGTGGTGTTTTCTACATTT
GACCAAGCTGGTATCGAACGGACCGGTCAAAATTGGAGCACATTTCTTCAACGTCAACAAAAAGCCGAGCGGGAG
GCTTCACTCAAAGATTTAGCCCATACGATGTTGACACGCCGATCGCAGTTAGGCTTCCGTAGCTTCGCAGTTGCT
AACTCACAAGACCAGCTGCAGAGCATCTTGGATAAAGGATTGCCCAAATTTCCCCGAGCTAGTCGCAAAGCTCAA
ACAAGACTTGCTTTTGTGTTCACGGGTCAGGGTGGCCAATGGGCTGGAATGGGCCGGGAGCTTTTGAGGATTCCC
ACTTTCAGGGAAAGTATAGCACGATCACAGGAAATTCTTTCGTCCCTGGGATGTCCCTTTGATATGGTGGAGGAG
ATAAAGGCGGAGGCAAAAGACAGTCAGATAAACCGACCTGATCGCAGCCAGCCTATCACCTGCGCATTGCAGATT
GCTTTGGTTGATCTTCTGGCCAGTTGGTCGGTTTTTCCCAACGCAGTGGTTGGCCACTCCAGCGGTGAAATTGCT
GCTGGATATGCCGCTGGGTATCTTTCTCGTGAAGACGCTATGCGAGTCGCATGGTTCCGCGGTTTCTTTTCGCAG
CAGATTGCCCAGAGTGACAGACGAGGTGGTATGCTCGCTACTGGTATTTCTGCGGCTGACGCAAAGAAGTACCTC
GAGGAGCTGCCTGCACGTTCAGTTGTGGTTGCCTGTGTCAATAGTCCTGCCAGTACAACCCTCTCGGGTGATGTG
GAATTCATTGATCAGCTTGAAGCAAGATTACAACAGGATGGTCACTTTGCCCGGAAGCTGCGCATTGATACAGCT
TATCATTCCCCTCACATGGAAGATCTAGTTAAAGTGGTAGGTAGTGCTATCGATTGTATCAAGCCTGAGGATCGA
TACAATGGCTCAATTCCCATGCTTTCATCGGTCACAAAAGAGCGTGTCTATCCCGCCGAACTTGGTGGATCATAC
TGGGTACGCAACATGGTCAGCTCGGTTGAGTTTACTGCCGCAGTGTCACAACTCGCAAACCTGAGCGAGTCTATC
AAGTCTCGCCGACGGCCGGTTCCAATAAAATGGACCGCTTTGATTGAAATCGGTCCACACGCCGTTTTAAAAGGA
CCTGTCACTCAAATCCTGCAGTCTGTCAACGCAAATATGGCATCATTGCCGTACTATTCGTTGGTTTCACGGAAC
CAGCATGCTTTGCGAACAGCATTGGAAGTTGCTGGCTCGCTTTGGAGCACAGGACACACAATAGACCTTGCTGCG
GTCAACAGCAGTGTCGATAATACAAGCCCAAAAATGATTCCAGATTTGCCTTCTTATCCTTGGAATCACCAAACG
TCCTTCTGGCACGAGCCATTAGAGACAGCGCAGTTGAGACAACGTCAGCATCCACGTCATGATATTCTGGGAGCT
GCCGTAGATTTTCAAAACGCTTTAGAGCCAAGATGGAGAAACTTCCTGCGACTCTCCGAGAATCCATGGATGGCC
GATCATGTTGTCGCCGGATCGATTGTGTTCCCAGCCGCGGGAATGTTGGTGATGGCTACTGAGGCGGCGCGGCAA
CTAGCTGATAGCCCAGCCAACATCAAAGGAATAGAATTCCAAGACCTTCATTTTATGCGAGGGGTTGTTATCCCA
GACGAGGAACGCGGCTTGGAAACTCTTCTTCAGGTCTCCCCTCATCCAGGGATGCCGGGTTGGTATCAGTTCGGA
ATTTTCTCACTTCCCTCGGGGGGTGCTTGGATTCAACACGCGAAGGGTGCATTCATTGCGCGATTCGAGAACCGA
ACCGACGATGAGCATAATTCAAACTGGCAAGCAGCGTTGGAACGCATCAAGAATACCCAAACAGTCGCCAAAATG
GCTGACGTTGGACAAGCACGTGAATGGTTGTCTAACACAGGAGGACTCACCGTAGGACCGGCCTTCCAGACAGTC
ACTGGCGTTTCTTTTTGCGATTCAGAGTCTCGTCTCTGGCTATCCGGGGTCGTCACAGACACAAAACAATCAATG
CCTTTCGAAAAGGAGTCATCCAGTTTTATCCATCCCACAACTCTTGATTGCCTCTTCCAGTCTGCCCTGTTGTCC
TGCTCTGATGCATTATCCAGCAACAAAGCAAATATTCCGATCGGAGTGGACAATATCTACATATCCAATACGTTC
CAACCCCAACCGGGGGAGCAGTTTGTCGTCCACACAGAGACCAAGTGGCGAGACGGGAAATCACAATCCCACTGT
ATCGCGTCGGACCCCACCTGGTCACAACCCTGGATCACGTTTGAAGGTGTTCATCTCGGTCGCCTTCCCTTCAAC
TCAAATTCTCTAAAGCAAGAGGAAGCATCTTCGGAGAGCCGATATTCGTCGATTGTTTGGGATGAACACTTGGAG
TCGCCGCTTGTCACTAGCCAAATCAATGACGGAAACAAGAAGAAGGCCGTGCAAGCCAGCAGTCTCCAACTAACA
GACTGGATCAAGAGATTGTGCTATACCAACGGGGATGCCAGAGCACTCATTACTACTTCGGACACATCCTCTTGG
ATCGCAAGTCTACAAGAGCTGATTCCAAGTGCCGGCAAGCGGCCGTGCCTAGGAAGGATGACAGTCGCTTCATGT
GGCCACGAAAATCAAGTGGAGGGCGTCACTCCCACAGAGAACAGCCTCCCGGGAACTCACCTGGCATCCCTCACT
ACATTAAGCGAACTTCCATCTTCGTCGCTCGCTCAGGATAAATATGATTTGGTCGTGATCGATGAGCCCAAGTGG
GACGACAAAATCATTCAAGTTATCCTATCGTGTCTGCCCACCATTCTTGAACACGGAGGTTTAGCAGCAATACGG
GTATCAGGAACCAATCGAGACTCGGCAGCAGAGAAGTTGCAACGATTGGAAGGCCTTGAAATTCACAGCACGACC
AAAGATCGCGAGTTTATCATCGCGCGCAGAACACCAGTCTCGTGGACTACAGACTCCGAAATCTATATTTTGAGT
CCAGCCGACAAATCTAACACACTAGCTGTTTTCGAGCACCTTGGGAATATATTTGCCACCCATAACGTTCGTCTG
GTGCCTGTTGAATTGGAACAGGTGGGTACACTAGCAGGAAAGACTGTGATTTCTTTGCTTGACTTGGCAAGTCCC
TGGATATCCGGCTGGACGGAAAATGATTTGGAACGTCTCCAGGAGTTGATCCGAGTTAAATACGTTCTTTGGGTG
TCCCCTTCCTGGAGCCAAGGGGCTGTTGAGAATATTGGATCTGGTGCCACAGGCGGCCTTTTGCGAACACTTCGC
AATGAGCAGTGGAACACCACCATCCCACACCTATTGGTCGATGTGGAAGATTTGGAAGACAAGTTCGGACTAGCT
TGTGGCATTCTCCAAGTCATGCAGCTCACGACGCAGGAGAGCTCGCGCCGGCCAGACTTGGAGTATCGTCTGGCA
AACGGTCGGCTGCTAGTTCCACGGGTCATTGAGACTCCAACAGTGGATGAGGCCATGCACACTCTTATGAATGGC
CCCAGGCCTGTGATGTCAGACCTTACACTTGATCCGAGACGCCTTGAGTTGAAGTTCCAAGATGCAGACAACGCA
CGCTGGGAGGAACAACAACCATTCGAAGAGGGACTTCGCACTGACCACATTGAAATCATGGTTGAAATGGCCACA
ATCTTCGATTTACATGGGGATCAAGGGAAGACACCAGAGACAGCTCTTCCAATGTTCGAAATTGTTGGAAAGGTA
ACTCTTATCGGATCTGGTGTGCACGACTTGGCTGTTGGCGATAAAGTGTTAACCCTAACATCGGCGAGCTCGGGA
CTCATGACAGCAATGCGGGTCTTAGAAAGTGACACTATCAGGATTCCTGCAAATATGGACCCAAAAAATGCGATA
TCAACTCCTCTAGCGTACATAAACGCTTATCAGATTCTCACCCAAGTTGGTCGCCTCAGTTCAAGTTCCTCGGTG
CTTTTGGTCGGCTCAATCAGTCAAACTCTCCAGGCCATGATAGATTATGCCCTTGCCATGAACATGCAAGTCATC
GTGGCAACTGATTCTGCAGATACCACCGAGAACCTTCGTTCTCGCTACCCAGTATTAGCGGATCGAATTCTCGGC
GTTCACGGTAGCCTAGAAACAAGTGTGTCTAGGCTAACCAACGGATGTGGAGTTGACGCCAGCATTTGCTTCCTT
GGCGGCTATGCGGGTCGGAATGCTGCTAGGTGTCTTGTCCCAGGTGGACAGTACATTAATCTATCTAGCGAGATG
AAGATGAGTGCTCTTCCAGAGAGCTTCATTGACAGTGGCTGCACATTCTCTTCGCCGCGACTGCAGAAAATTTTC
TCGGAGAAACCCGGCAATCTTCATGCTTCAGTACGGCATGTGGTTGACTTCATGAAGCAGCATAGGATGTTGGAC
CGCGTGGAGTCCTATTCTATGTTCCCCGTTTCTGATCTCCAAGGAGCTTTGAAACATTGCAAAGTGGCCAATACC
CGAGCTATCGTGGATCTTCGGGCTCCTGGAAGGGTCCCTATTGTTCTGCCACTGCCAAATCTTACTGGCTTGCCA
GCGGAAGGCACATATATACTAGCAGGTGGATTAGGAAACCTCGGCCTTGCGCTTGCCGATACCTTGGTGCAGTCC
GGGGCCCGCCATTTGGTTTTCCTTGGAAGATCTGGCGGGGCACAACCTGGTCAACAGCTAGCCCTTGATCTCCTT
CGCTCTCATGGGTGCCGCATAGATGTACTGCGCTGTGATATCGCCCAACAGGCAGATATTGACCACCTGTCATAC
AAGATTCGGAGTAAGAACTGGACCGTTGCAGGCGTGATTCAGTGTACAACAGTTCTGAAGGACGCAATGTTCGAG
AACATGACTTTTGATGATTGGACCCAATCCACACAGTCCAAGATCCGCGGGACACTGAACTTGCACCATCTATTT
TCGGAATTTGAAGGCTTGGGTTTCTTCATTGCTTTGTCTTCCGTGGCCAGTGTCATTGGTAATATGGGACAGGCT
AACTATTCTGCGGGCAATGGTTTCATTGACGCTCTCATGGAATGGCGACGCAGTCACGGTCTCCCAGGTCATTCT
ATCAATATTGGCCTCGTTCCAGATGCTAGTGGACTCAGCGACATTGCCGAAGATCAAGAGCAACGCCGCCGCCGA
TACAAACATCTTGAGGGTACAGAAATCATGACCCATGAGCTCCAGACCTTGCTCAGAGTGATCATTAACAGCAAG
CTTTCTCTTCCATCTCAAATAATTGCTGGCATGACCGATCATCTGTCTCGCAGCAATGGCTCCATAGCCTGGGTT
CTCGATCGAAAGTTTGATCACCGGCTTTGCCTTGCTGCCGATGACACTGAGGACTCTATTCAGACTAGCGCCTTA
CTCAAGGGGTGTGACTCCCTTGACAATGCAACTGAGGTTGTCCTTAACGCTCTGAGTGAATATCTAGCAGATGCA
ATGGCTACAACTGCCGATGCTATCGACTCAGATCTACCATTGTCCGCGTTGGGAGTTGATTCCCTGAAAGCTACA
GCCGTTCAAAACTGGGTCTCTCGCGAACTGGGGTCAGAACTATCCTCCTTCGAGTTTCTTGGCTCACAACCGACC
AAGGCGTTAGCGAGGAAAATTGCTTCTACTAGTTCGTTTGTCTCGGTGCCGAGCTGA
Gene >Pro_DTO377G3_2|g8606.t1
ATGGAGGGAATTGCAGTCATTGGAATGGGGTGTCGCTTCTCTGGAGGAGCGACCTCCGTTGAGAACTTCTGGCAG
ATGCTATGCGACGGACGTACTGGGCATGGGACAGTTCCCACAAGCCGATACCAAGCTTCGGCCTGGCATCACCCT
AGCCATGAACGCAAAGGAGCGGTATGAATACCTCAATTAGATGTTAGTTTACTATTCTAACAGGATGAATAGATC
AATCATGATAGTGGGTTTTTCTTGCAGGAAGATCCATCACGGTTTGACGCTCCTTTTTTCTCTATCACTGCCAAA
GAGGCGGCGGGCATGGACCCAGCACAACGTTTGTTGCTCGAAGTTGCATACGAAACATTCGAAAACAGTAAGTTG
AGTGATTTTCACGTTTCCGGAAAGAAGTCAGCTAATAGGGAAAAATAGGCGGGATACCGATAGACACGCTTCCAG
GCAGTAACACGGCAGTGTACTCTGGTTCAATGACCAATGACTATGAGCTATTGTCAACAAGAGATATCTATGATA
TGCCTCACAACTCGGCTACTGGTAATGGAAGGACTATGCTGGCAAATCGGTTGTCATGGTTCTTTGATCTTCAAG
GCCCAAGTATCATGATGGATACTGCGTGTTCTTCAAGTTTGACTGCGATCCACCTAGCAGCTCAATCCTTGCGGT
CTGGAGAGTGCGGAATGGTGAGCACTGCAATCTGATGTCTATTGATCACACAGACTAAACATGCTTGTGACAGGC
CTTGGTGACTGGTGCCAGTCTTATCTTGCACCCTAATTTTACACAAAGACTGTCCTACATGCACATGATGAGTGC
AGATGGCATAAGTCATTCATTTGATGAGTCTGCAAATGGATATGGTCGGGGTGAGGGCATCGGTGCTGTGCTTTT
GAAGCCCCTCAGCGCCGCATTAGCCGATGGAGATAATATTCGAGCCGTCATCCGCGGCACAGGAATTAATCAGGA
TGGCCGGACTCCTGGGATTACACTGCCCAGTCCAACGTCCCAAGCCAACTTGATTCGTTCGGTTTATGAACGTCA
TGGCATCTCAATGAGAGACACTTCCTACTTTGAAGCACATGGCACTGGAACTCCTGTCGGGGTAAGCAAAATAGC
TCCATTGATGGATAAAAAGCCATCGTTTGATTAACTCAATGATGAATAGGATCCCATAGAGCTGTCTGCTGTCGG
AATGACTTTGGGCCAGGCACGAACACCGACTGATGAGCCAATATACGTAGGCTCAGTGAAGACAAATTTCGGTCA
CACCGAAGGAGCCGCAGGAGTGGCTAGCTTGATCAAAGTCGTGCTGTGTTTAGAAAAGGGCACATTGGTGCCAAA
CGCCGGGTTCCAAAACATCAATCCCAAGATCCGGCTCGATGATTGGCGTTTACGCCTAAGCGACAAAACAATGCC
CTGGCCAGACCATCTTCCGCAGCGGGCTAGTATCAACTCATTTGGATTCGGTGGATCAAATGCGCATTTGATTCT
CGAAAGTGCCAAAGAAGCCCTGGGCAATGCTAAAGACCAGGAGCCGGCCCCTCATGTGGTGGTGTTTTCTACATT
TGACCAAGCTGGTATCGAACGGACCGGTCAAAATTGGAGCACATTTCTTCAACGTCAACAAAAAGCCGAGCGGGA
GGCTTCACTCAAAGATTTAGCCCATACGATGTTGACACGCCGATCGCAGTTAGGCTTCCGTAGCTTCGCAGTTGC
TAACTCACAAGACCAGCTGCAGAGCATCTTGGATAAAGGATTGCCCAAATTTCCCCGAGCTAGTCGCAAAGCTCA
AACAAGACTTGCTTTTGTGTTCACGGGTCAGGGTGGCCAATGGGCTGGAATGGGCCGGGAGCTTTTGAGGATTCC
CACTTTCAGGGAAAGTATAGCACGATCACAGGAAATTCTTTCGTCCCTGGGATGTCCCTTTGATATGGTGGAGGA
GATAAAGGCGGAGGCAAAAGACAGTCAGATAAACCGACCTGATCGCAGCCAGCCTATCACCTGCGCATTGCAGAT
TGCTTTGGTTGATCTTCTGGCCAGTTGGTCGGTTTTTCCCAACGCAGTGGTTGGCCACTCCAGCGGTGAAATTGG
TATGCAAATCTCCGTTATTCTCGCTTCAAACAAGCATCCAATGATGAATAAAAGCTGACTTATTTGCAACACGTA
GCTGCTGGATATGCCGCTGGGTATCTTTCTCGTGAAGACGCTATGCGAGTCGCATGGTTCCGCGGTTTCTTTTCG
CAGCAGATTGCCCAGAGTGACAGACGAGGTGGTATGCTCGCTACTGGTATTTCTGCGGCTGACGCAAAGAAGTAC
CTCGAGGAGCTGCCTGCACGTTCAGTTGTGGTTGCCTGTGTCAATAGTCCTGCCAGTACAACCCTCTCGGGTGAT
GTGGAATTCATTGATCAGCTTGAAGCAAGATTACAACAGGATGGTCACTTTGCCCGGAAGCTGCGCATTGATACA
GCTTATCATTCCCCTCACATGGAAGATCTAGTTAAAGTGGTAGGTAGTGCTATCGATTGTATCAAGCCTGAGGAT
CGATACAATGGCTCAATTCCCATGCTTTCATCGGTCACAAAAGAGCGTGTCTATCCCGCCGAACTTGGTGGATCA
TACTGGGTACGCAACATGGTCAGCTCGGTTGAGTTTACTGCCGCAGTGTCACAACTCGCAAACCTGAGCGAGTCT
ATCAAGTCTCGCCGACGGCCGGTTCCAATAAAATGGACCGCTTTGATTGAAATCGGTCCACACGCCGTTTTAAAA
GGACCTGTCACTCAAATCCTGCAGTCTGTCAACGCAAATATGGCATCATTGCCGTACTATTCGTTGGTTTCACGG
AACCAGCATGCTTTGCGAACAGCATTGGAAGTTGCTGGCTCGCTTTGGAGCACAGGACACACAATAGACCTTGCT
GCGGTCAACAGCAGTGTCGATAATACAAGCCCAAAAATGATTCCAGATTTGCCTTCTTATCCTTGGAATCACCAA
ACGTCCTTCTGGCACGAGCCATTAGAGACAGCGCAGTTGAGACAACGTCAGCATCCACGTCATGATATTCTGGGA
GCTGCCGTAGATTTTCAAAACGCTTTAGAGCCAAGATGGAGAAACTTCCTGCGACTCTCCGAGAATCCATGGATG
GCCGATCATGTTGTCGCCGGATCGATTGTGTTCCCAGCCGCGGGAATGTTGGTGATGGCTACTGAGGCGGCGCGG
CAACTAGCTGATAGCCCAGCCAACATCAAAGGAATAGAATTCCAAGACCTTCATTTTATGCGAGGGGTTGTTATC
CCAGACGAGGAACGCGGCTTGGAAACTCTTCTTCAGGTCTCCCCTCATCCAGGGATGCCGGGTTGGTATCAGTTC
GGAATTTTCTCACTTCCCTCGGGGGGTGCTTGGATTCAACACGCGAAGGGTGCATTCATTGCGCGATTCGAGAAC
CGAACCGACGATGAGCATAATTCAAACTGGCAAGCAGCGTTGGAACGCATCAAGAATACCCAAACAGTCGCCAAA
ATGGCTGACGTTGGACAAGCACGTGAATGGTTGTCTAACACAGGAGGACTCACCGTAGGACCGGCCTTCCAGACA
GTCACTGGCGTTTCTTTTTGCGATTCAGAGTCTCGTCTCTGGCTATCCGGGGTCGTCACAGACACAAAACAATCA
ATGCCTTTCGAAAAGGAGTCATCCAGTTTTATCCATCCCACAACTCTTGATTGCCTCTTCCAGTCTGCCCTGTTG
TCCTGCTCTGATGCATTATCCAGCAACAAAGCAAATATTCCGATCGGAGTGGACAATATCTACATATCCAATACG
TTCCAACCCCAACCGGGGGAGCAGTTTGTCGTCCACACAGAGACCAAGTGGCGAGACGGGAAATCACAATCCCAC
TGTATCGCGTCGGACCCCACCTGGTCACAACCCTGGATCACGTTTGAAGGTGTTCATCTCGGTCGCCTTCCCTTC
AACTCAAATTCTCTAAAGCAAGAGGAAGCATCTTCGGAGAGCCGATATTCGTCGATTGTTTGGGATGAACACTTG
GAGTCGCCGCTTGTCACTAGCCAAATCAATGACGGAAACAAGAAGAAGGCCGTGCAAGCCAGCAGTCTCCAACTA
ACAGACTGGATCAAGAGATTGTGCTATACCAACGGGGATGCCAGAGCACTCATTACTACTTCGGACACATCCTCT
TGGATCGCAAGTCTACAAGAGCTGATTCCAAGTGCCGGCAAGCGGCCGTGCCTAGGAAGGATGACAGTCGCTTCA
TGTGGCCACGAAAATCAAGTGGAGGGCGTCACTCCCACAGAGAACAGCCTCCCGGGAACTCACCTGGCATCCCTC
ACTACATTAAGCGAACTTCCATCTTCGTCGCTCGCTCAGGATAAATATGATTTGGTCGTGATCGATGAGCCCAAG
TGGGACGACAAAATCATTCAAGTTATCCTATCGTGTCTGCCCACCATTCTTGAACACGGAGGTTTAGCAGCAATA
CGGGTATCAGGAACCAATCGAGACTCGGCAGCAGAGAAGTTGCAACGATTGGAAGGCCTTGAAATTCACAGCACG
ACCAAAGATCGCGAGTTTATCATCGCGCGCAGAACACCAGTCTCGTGGACTACAGACTCCGAAATCTATATTTTG
AGTCCAGCCGACAAATCTAACACACTAGCTGTTTTCGAGCACCTTGGGAATATATTTGCCACCCATAACGTTCGT
CTGGTGCCTGTTGAATTGGAACAGGTGGGTACACTAGCAGGAAAGACTGTGATTTCTTTGCTTGACTTGGCAAGT
CCCTGGATATCCGGCTGGACGGAAAATGATTTGGAACGTCTCCAGGAGTTGATCCGAGTTAAATACGTTCTTTGG
GTGTCCCCTTCCTGGAGCCAAGGGGCTGTTGAGAATATTGGATCTGGTGCCACAGGCGGCCTTTTGCGAACACTT
CGCAATGAGCAGTGGAACACCACCATCCCACACCTATTGGTCGATGTGGAAGATTTGGAAGACAAGTTCGGACTA
GCTTGTGGCATTCTCCAAGTCATGCAGCTCACGACGCAGGAGAGCTCGCGCCGGCCAGACTTGGAGTATCGTCTG
GCAAACGGTCGGCTGCTAGTTCCACGGGTCATTGAGACTCCAACAGTGGATGAGGCCATGCACACTCTTATGAAT
GGCCCCAGGCCTGTGATGTCAGACCTTACACTTGATCCGAGACGCCTTGAGTTGAAGTTCCAAGATGCAGACAAC
GCACGCTGGGAGGAACAACAACCATTCGAAGAGGGACTTCGCACTGACCACATTGAAATCATGGTTGAAATGGCC
ACAATCTTCGATTTACATGGGGATCAAGGGAAGACACCAGAGACAGCTCTTCCAATGTTCGAAATTGTTGGAAAG
GTAACTCTTATCGGATCTGGTGTGCACGACTTGGCTGTTGGCGATAAAGTGTTAACCCTAACATCGGCGAGCTCG
GGACTCATGACAGCAATGCGGGTCTTAGAAAGTGACACTATCAGGATTCCTGCAAATATGGACCCAAAAAATGCG
ATATCAACTCCTCTAGCGTACATAAACGCTTATCAGATTCTCACCCAAGTTGGTCGCCTCAGTTCAAGTTCCTCG
GTGCTTTTGGTCGGCTCAATCAGTCAAACTCTCCAGGCCATGATAGATTATGCCCTTGCCATGAACATGCAAGTC
ATCGTGGCAACTGATTCTGCAGATACCACCGAGAACCTTCGTTCTCGCTACCCAGTATTAGCGGATCGAATTCTC
GGCGTTCACGGTAGCCTAGAAACAAGTGTGTCTAGGCTAACCAACGGATGTGGAGTTGACGCCAGCATTTGCTTC
CTTGGCGGCTATGCGGGTCGGAATGCTGCTAGGTGTCTTGTCCCAGGTGGACAGTACATTAATCTATCTAGCGAG
ATGAAGATGAGTGCTCTTCCAGAGAGCTTCATTGACAGTGGCTGCACATTCTCTTCGCCGCGACTGCAGAAAATT
TTCTCGGAGAAACCCGGCAATCTTCATGCTTCAGTACGGCATGTGGTTGACTTCATGAAGCAGCATAGGATGTTG
GACCGCGTGGAGTCCTATTCTATGTTCCCCGTTTCTGATCTCCAAGGAGCTTTGAAACATTGCAAAGTGGCCAAT
ACCCGAGCTATCGTGGATCTTCGGGCTCCTGGAAGGGTCCCTATTGTTCTGCCACTGCCAAATCTTACTGGCTTG
CCAGCGGAAGGCACATATATACTAGCAGGTGGATTAGGAAACCTCGGCCTTGCGCTTGCCGATACCTTGGTGCAG
TCCGGGGCCCGCCATTTGGTTTTCCTTGGAAGATCTGGCGGGGCACAACCTGGTCAACAGCTAGCCCTTGATCTC
CTTCGCTCTCATGGGTGCCGCATAGATGTACTGCGCTGTGATATCGCCCAACAGGCAGATATTGACCACCTGTCA
TACAAGATTCGGAGTAAGAACTGGACCGTTGCAGGCGTGATTCAGTGTACAACAGTTCTGAAGGTTATTTACCCT
CATTTCGTTCGTTTTCATTGACACTAGCTAATTCCTTCGTTTATTATCAGGACGCAATGTTCGAGAACATGACTT
TTGATGATTGGACCCAATCCACACAGTCCAAGATCCGCGGGACACTGAACTTGCACCATCTATTTTCGGAATTTG
AAGGCTTGGGTTTCTTCATTGCTTTGTCTTCCGTGGCCAGTGTCATTGGTAATATGGGACAGGCTAACTATTCTG
CGGGCAATGGTTTCATTGACGCTCTCATGGAATGGCGACGCAGTCACGGTCTCCCAGGTCATTCTATCAATATTG
GCCTCGTTCCAGATGCTAGTGGACTCAGCGACATTGCCGAAGATCAAGAGCAACGCCGCCGCCGATACAAACATC
TTGAGGGTACAGAAATCATGACCCATGAGCTCCAGACCTTGCTCAGAGTGATCATTAACAGCAAGCTTTCTCTTC
CATCTCAAATAATTGCTGGCATGACCGATCATCTGTCTCGCAGCAATGGCTCCATAGCCTGGGTTCTCGATCGAA
AGTTTGATCACCGGCTTTGCCTTGCTGCCGATGACACTGAGGACTCTATTCAGACTAGCGCCTTACTCAAGGGGT
GTGACTCCCTTGACAATGCAACTGAGGTTGTCCTTAACGCTCTGAGTGAATATCTAGCAGATGCAATGGCTACAA
CTGCCGATGCTATCGACTCAGATCTACCATTGTCCGCGTTGGGAGGTATGTCTTTTGATGATTTTTCCCCACTGT
GACTTTTGTCTTGACTAACACTGGCTTCTAACTAGTTGATTCCCTGAAAGCTACAGCCGTTCAAAACTGGGTCTC
TCGCGAACTGGGGTCAGAACTATCCTCCTTCGAGTTTCTTGGCTCACAACCGACCAAGGCGTTAGCGAGGAAAAT
TGCTTCTACTAGTTCGTTTGTCTCGGTGCCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail