Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8599.t1
Gene name
Locationscaffold_35:25459..27901
Strand+
Gene length (bp)2442
Transcript length (bp)2442
Coding sequence length (bp)2442
Protein length (aa) 814

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01326 PPDK_N Pyruvate phosphate dikinase, AMP/ATP-binding domain 2.5E-111 29 350
PF02896 PEP-utilizers_C PEP-utilising enzyme, PEP-binding domain 3.6E-61 489 798
PF00391 PEP-utilizers PEP-utilising enzyme, mobile domain 7.8E-24 394 464

GO

GO Term Description Terminal node
GO:0016310 phosphorylation Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups Yes
GO:0005524 ATP binding Yes
GO:0016301 kinase activity Yes
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 833.48 419.26 1247.70
5d_25C Five days - 25 degrees Celsius 1506.09 655.62 2356.57
7d_25C Seven days - 25 degrees Celsius 1473.98 641.28 2306.68
10d_25C Ten days - 25 degrees Celsius 1557.94 678.57 2437.30
7d_15C Seven days - 15 degrees Celsius 1383.14 571.01 2195.27
7d_30C Seven days - 30 degrees Celsius 1017.84 476.32 1559.36

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.042422 yes
3d_25C 7d_25C 0.050137 no
3d_25C 7d_15C 0.090345 no
3d_25C 7d_30C 0.548877 no
3d_25C 10d_25C 0.027043 yes
5d_25C 7d_25C 0.966128 no
5d_25C 7d_15C 0.854888 no
5d_25C 7d_30C 0.213284 no
5d_25C 10d_25C 0.944740 no
7d_25C 7d_15C 0.894143 no
7d_25C 7d_30C 0.243542 no
7d_25C 10d_25C 0.908082 no
7d_15C 7d_30C 0.364400 no
7d_15C 10d_25C 0.787675 no
7d_30C 10d_25C 0.172783 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8599.t1
MAGTGNTKVVHDIGNLVVHFEHLTRSDVALVGGKNSSIGEMIGTLGGEGISVPSGFATTSLAYRRYIDGNKIRDG
ITRLIKDWQTGKANLAETGLAIRNLILRGSWPPDVETAIRRAYHELSAKLGIENPSVAVRSSATAEDLPDASFAG
QQDSYLNISGEDRLLNACRRCYASLFNDRAISYRQAKGFDHMSVALSIGIQQMVRSDANGSGVMFSIDTESGFDK
IVLINAAWGLGENIVQGTVNPDEYQVFKPLLRDENLLPIIEKKCGDKAMKMVYGEDVPTRNIPTSKAERAAFVLG
DQEILQLSRWACTIEKHYGCPMDIEWAKDGITGELFIVQARPETVQSRRDAGVFTTFQVGKRGRILTKGLSVGDA
AVSGRLCLIEKSEDIDNFVDGSIMVTKSTDPDWVPLMKRATAIITDHGGRTSHAAIVSRELGLPAVVGTGNGTYV
LHTGQDVTVSCAEGDEGFVYEGTSEISTQTVDLAGLPAVDTDIMINLANPAAAYRWWRLPTDGIGLARMEFVVTN
YIRIHPMALVHFDQLKDDKSKEEIARLTAGYSNKPEYFVDKLSHGFAALCATVYPKPAILRMSDFKTNEYAGLIG
GSQFEPKEENPMLGFRGASRYYSPLYKEGFELECRAIKRLREEMGFANVIVMIPFCRTISEAKEVLKTMSENGLK
RGDKGLQVYVMCEIPSNVIMANEFSEYFDGFSIGSNDLTQLTLGVDRDSGELAGLFNEQDEAVKWMIARVIIVAR
KAGRKIGICGQAPSDHPEFAKFLVEAGINSISVSPDSFVQVKRQVLESERKRLDLIADEHIML*
Coding >Pro_DTO377G3_2|g8599.t1
ATGGCAGGAACTGGGAATACGAAAGTTGTACATGATATCGGAAATTTGGTTGTTCATTTTGAACATCTAACGCGC
AGTGATGTCGCCTTGGTCGGAGGGAAGAACTCCTCCATTGGAGAAATGATAGGCACCCTTGGAGGTGAAGGAATC
TCTGTACCTTCTGGTTTTGCCACGACGTCGCTAGCATACAGGCGCTATATCGATGGGAACAAAATCCGCGATGGA
ATAACCAGGCTGATCAAGGACTGGCAAACGGGAAAAGCAAATCTTGCCGAAACCGGCTTGGCAATACGCAATTTG
ATACTCCGCGGCTCTTGGCCACCCGATGTTGAAACAGCCATCCGGAGAGCCTATCACGAACTCTCGGCCAAATTA
GGAATTGAGAACCCGAGCGTTGCCGTGCGTTCAAGCGCGACAGCAGAAGACTTGCCAGATGCGAGTTTTGCTGGA
CAACAGGATTCCTATCTGAACATCTCAGGTGAAGATCGATTGTTGAATGCCTGTCGCCGCTGCTATGCGTCTCTT
TTCAACGACCGCGCCATCAGCTATCGCCAAGCCAAAGGGTTTGATCACATGAGCGTTGCCCTCTCGATTGGCATA
CAACAAATGGTTCGCTCCGATGCCAACGGGTCAGGGGTCATGTTCTCCATCGATACCGAAAGTGGCTTTGACAAG
ATTGTGCTCATCAACGCAGCGTGGGGACTAGGAGAGAATATAGTACAAGGGACTGTCAATCCTGACGAATACCAA
GTGTTCAAACCACTTCTGAGAGATGAGAACCTTTTGCCGATCATAGAGAAAAAATGCGGGGACAAGGCAATGAAA
ATGGTCTACGGGGAAGATGTACCGACGCGGAATATACCTACGTCAAAGGCGGAGCGCGCTGCTTTTGTGCTTGGC
GATCAGGAAATTCTTCAGTTGAGCCGCTGGGCATGCACCATTGAAAAGCACTATGGCTGTCCAATGGACATAGAA
TGGGCAAAAGATGGCATCACGGGCGAATTGTTCATCGTCCAGGCCCGCCCAGAAACCGTTCAATCGCGTCGTGAC
GCTGGTGTCTTCACGACTTTCCAGGTAGGAAAGAGAGGCCGCATTCTTACGAAGGGACTTTCAGTTGGAGACGCG
GCAGTATCTGGCCGTCTCTGTCTCATTGAAAAGTCTGAAGACATTGACAACTTCGTCGACGGCTCGATCATGGTG
ACTAAATCGACCGACCCGGATTGGGTGCCTCTAATGAAGCGGGCCACGGCTATCATCACCGACCATGGTGGCCGT
ACTTCACATGCCGCCATTGTAAGTCGCGAGCTCGGCCTCCCAGCCGTGGTGGGCACAGGAAATGGAACATACGTT
TTACACACAGGCCAAGACGTAACTGTTTCCTGTGCCGAGGGTGACGAAGGCTTCGTCTACGAGGGTACCAGCGAA
ATTTCCACCCAAACAGTGGACCTAGCCGGCCTCCCAGCAGTTGATACGGATATTATGATCAATCTCGCTAACCCA
GCGGCGGCTTACCGCTGGTGGCGACTTCCGACCGATGGCATCGGCCTTGCTCGCATGGAGTTTGTCGTAACCAAT
TATATTCGAATTCATCCGATGGCGCTCGTCCACTTTGATCAGTTAAAGGACGACAAATCCAAGGAAGAAATCGCG
CGATTGACAGCTGGGTACAGTAACAAGCCTGAATACTTCGTCGACAAGTTATCGCACGGTTTTGCGGCCCTTTGT
GCCACGGTATACCCCAAGCCGGCCATTCTCCGTATGAGTGACTTCAAGACAAACGAGTATGCTGGCCTCATCGGC
GGTTCTCAGTTTGAGCCGAAAGAGGAGAACCCAATGCTTGGCTTCCGCGGGGCCTCACGCTACTATTCACCGCTG
TACAAAGAGGGGTTCGAGCTTGAATGTCGCGCCATCAAGAGGCTGCGCGAGGAGATGGGCTTCGCAAATGTCATT
GTTATGATCCCTTTCTGCCGGACAATTAGCGAGGCAAAAGAAGTACTAAAAACTATGTCCGAGAACGGGCTTAAA
CGTGGTGACAAGGGTCTCCAAGTATACGTCATGTGCGAGATACCTTCCAACGTCATCATGGCCAATGAATTCTCT
GAGTACTTCGATGGGTTCTCAATCGGTTCAAACGATCTGACACAACTGACGCTCGGTGTCGACCGCGACTCTGGT
GAGCTGGCAGGCCTCTTCAATGAGCAAGACGAGGCTGTCAAGTGGATGATTGCTCGGGTAATCATAGTTGCTCGC
AAGGCGGGTCGTAAGATTGGCATTTGCGGGCAGGCCCCAAGCGATCATCCGGAATTCGCCAAGTTCCTAGTGGAA
GCCGGTATCAACTCGATCTCGGTCAGCCCTGACAGCTTTGTCCAAGTGAAAAGACAAGTTCTTGAGAGTGAGAGG
AAACGACTTGATTTGATAGCGGACGAACATATCATGCTTTAA
Transcript >Pro_DTO377G3_2|g8599.t1
ATGGCAGGAACTGGGAATACGAAAGTTGTACATGATATCGGAAATTTGGTTGTTCATTTTGAACATCTAACGCGC
AGTGATGTCGCCTTGGTCGGAGGGAAGAACTCCTCCATTGGAGAAATGATAGGCACCCTTGGAGGTGAAGGAATC
TCTGTACCTTCTGGTTTTGCCACGACGTCGCTAGCATACAGGCGCTATATCGATGGGAACAAAATCCGCGATGGA
ATAACCAGGCTGATCAAGGACTGGCAAACGGGAAAAGCAAATCTTGCCGAAACCGGCTTGGCAATACGCAATTTG
ATACTCCGCGGCTCTTGGCCACCCGATGTTGAAACAGCCATCCGGAGAGCCTATCACGAACTCTCGGCCAAATTA
GGAATTGAGAACCCGAGCGTTGCCGTGCGTTCAAGCGCGACAGCAGAAGACTTGCCAGATGCGAGTTTTGCTGGA
CAACAGGATTCCTATCTGAACATCTCAGGTGAAGATCGATTGTTGAATGCCTGTCGCCGCTGCTATGCGTCTCTT
TTCAACGACCGCGCCATCAGCTATCGCCAAGCCAAAGGGTTTGATCACATGAGCGTTGCCCTCTCGATTGGCATA
CAACAAATGGTTCGCTCCGATGCCAACGGGTCAGGGGTCATGTTCTCCATCGATACCGAAAGTGGCTTTGACAAG
ATTGTGCTCATCAACGCAGCGTGGGGACTAGGAGAGAATATAGTACAAGGGACTGTCAATCCTGACGAATACCAA
GTGTTCAAACCACTTCTGAGAGATGAGAACCTTTTGCCGATCATAGAGAAAAAATGCGGGGACAAGGCAATGAAA
ATGGTCTACGGGGAAGATGTACCGACGCGGAATATACCTACGTCAAAGGCGGAGCGCGCTGCTTTTGTGCTTGGC
GATCAGGAAATTCTTCAGTTGAGCCGCTGGGCATGCACCATTGAAAAGCACTATGGCTGTCCAATGGACATAGAA
TGGGCAAAAGATGGCATCACGGGCGAATTGTTCATCGTCCAGGCCCGCCCAGAAACCGTTCAATCGCGTCGTGAC
GCTGGTGTCTTCACGACTTTCCAGGTAGGAAAGAGAGGCCGCATTCTTACGAAGGGACTTTCAGTTGGAGACGCG
GCAGTATCTGGCCGTCTCTGTCTCATTGAAAAGTCTGAAGACATTGACAACTTCGTCGACGGCTCGATCATGGTG
ACTAAATCGACCGACCCGGATTGGGTGCCTCTAATGAAGCGGGCCACGGCTATCATCACCGACCATGGTGGCCGT
ACTTCACATGCCGCCATTGTAAGTCGCGAGCTCGGCCTCCCAGCCGTGGTGGGCACAGGAAATGGAACATACGTT
TTACACACAGGCCAAGACGTAACTGTTTCCTGTGCCGAGGGTGACGAAGGCTTCGTCTACGAGGGTACCAGCGAA
ATTTCCACCCAAACAGTGGACCTAGCCGGCCTCCCAGCAGTTGATACGGATATTATGATCAATCTCGCTAACCCA
GCGGCGGCTTACCGCTGGTGGCGACTTCCGACCGATGGCATCGGCCTTGCTCGCATGGAGTTTGTCGTAACCAAT
TATATTCGAATTCATCCGATGGCGCTCGTCCACTTTGATCAGTTAAAGGACGACAAATCCAAGGAAGAAATCGCG
CGATTGACAGCTGGGTACAGTAACAAGCCTGAATACTTCGTCGACAAGTTATCGCACGGTTTTGCGGCCCTTTGT
GCCACGGTATACCCCAAGCCGGCCATTCTCCGTATGAGTGACTTCAAGACAAACGAGTATGCTGGCCTCATCGGC
GGTTCTCAGTTTGAGCCGAAAGAGGAGAACCCAATGCTTGGCTTCCGCGGGGCCTCACGCTACTATTCACCGCTG
TACAAAGAGGGGTTCGAGCTTGAATGTCGCGCCATCAAGAGGCTGCGCGAGGAGATGGGCTTCGCAAATGTCATT
GTTATGATCCCTTTCTGCCGGACAATTAGCGAGGCAAAAGAAGTACTAAAAACTATGTCCGAGAACGGGCTTAAA
CGTGGTGACAAGGGTCTCCAAGTATACGTCATGTGCGAGATACCTTCCAACGTCATCATGGCCAATGAATTCTCT
GAGTACTTCGATGGGTTCTCAATCGGTTCAAACGATCTGACACAACTGACGCTCGGTGTCGACCGCGACTCTGGT
GAGCTGGCAGGCCTCTTCAATGAGCAAGACGAGGCTGTCAAGTGGATGATTGCTCGGGTAATCATAGTTGCTCGC
AAGGCGGGTCGTAAGATTGGCATTTGCGGGCAGGCCCCAAGCGATCATCCGGAATTCGCCAAGTTCCTAGTGGAA
GCCGGTATCAACTCGATCTCGGTCAGCCCTGACAGCTTTGTCCAAGTGAAAAGACAAGTTCTTGAGAGTGAGAGG
AAACGACTTGATTTGATAGCGGACGAACATATCATGCTTTAA
Gene >Pro_DTO377G3_2|g8599.t1
ATGGCAGGAACTGGGAATACGAAAGTTGTACATGATATCGGAAATTTGGTTGTTCATTTTGAACATCTAACGCGC
AGTGATGTCGCCTTGGTCGGAGGGAAGAACTCCTCCATTGGAGAAATGATAGGCACCCTTGGAGGTGAAGGAATC
TCTGTACCTTCTGGTTTTGCCACGACGTCGCTAGCATACAGGCGCTATATCGATGGGAACAAAATCCGCGATGGA
ATAACCAGGCTGATCAAGGACTGGCAAACGGGAAAAGCAAATCTTGCCGAAACCGGCTTGGCAATACGCAATTTG
ATACTCCGCGGCTCTTGGCCACCCGATGTTGAAACAGCCATCCGGAGAGCCTATCACGAACTCTCGGCCAAATTA
GGAATTGAGAACCCGAGCGTTGCCGTGCGTTCAAGCGCGACAGCAGAAGACTTGCCAGATGCGAGTTTTGCTGGA
CAACAGGATTCCTATCTGAACATCTCAGGTGAAGATCGATTGTTGAATGCCTGTCGCCGCTGCTATGCGTCTCTT
TTCAACGACCGCGCCATCAGCTATCGCCAAGCCAAAGGGTTTGATCACATGAGCGTTGCCCTCTCGATTGGCATA
CAACAAATGGTTCGCTCCGATGCCAACGGGTCAGGGGTCATGTTCTCCATCGATACCGAAAGTGGCTTTGACAAG
ATTGTGCTCATCAACGCAGCGTGGGGACTAGGAGAGAATATAGTACAAGGGACTGTCAATCCTGACGAATACCAA
GTGTTCAAACCACTTCTGAGAGATGAGAACCTTTTGCCGATCATAGAGAAAAAATGCGGGGACAAGGCAATGAAA
ATGGTCTACGGGGAAGATGTACCGACGCGGAATATACCTACGTCAAAGGCGGAGCGCGCTGCTTTTGTGCTTGGC
GATCAGGAAATTCTTCAGTTGAGCCGCTGGGCATGCACCATTGAAAAGCACTATGGCTGTCCAATGGACATAGAA
TGGGCAAAAGATGGCATCACGGGCGAATTGTTCATCGTCCAGGCCCGCCCAGAAACCGTTCAATCGCGTCGTGAC
GCTGGTGTCTTCACGACTTTCCAGGTAGGAAAGAGAGGCCGCATTCTTACGAAGGGACTTTCAGTTGGAGACGCG
GCAGTATCTGGCCGTCTCTGTCTCATTGAAAAGTCTGAAGACATTGACAACTTCGTCGACGGCTCGATCATGGTG
ACTAAATCGACCGACCCGGATTGGGTGCCTCTAATGAAGCGGGCCACGGCTATCATCACCGACCATGGTGGCCGT
ACTTCACATGCCGCCATTGTAAGTCGCGAGCTCGGCCTCCCAGCCGTGGTGGGCACAGGAAATGGAACATACGTT
TTACACACAGGCCAAGACGTAACTGTTTCCTGTGCCGAGGGTGACGAAGGCTTCGTCTACGAGGGTACCAGCGAA
ATTTCCACCCAAACAGTGGACCTAGCCGGCCTCCCAGCAGTTGATACGGATATTATGATCAATCTCGCTAACCCA
GCGGCGGCTTACCGCTGGTGGCGACTTCCGACCGATGGCATCGGCCTTGCTCGCATGGAGTTTGTCGTAACCAAT
TATATTCGAATTCATCCGATGGCGCTCGTCCACTTTGATCAGTTAAAGGACGACAAATCCAAGGAAGAAATCGCG
CGATTGACAGCTGGGTACAGTAACAAGCCTGAATACTTCGTCGACAAGTTATCGCACGGTTTTGCGGCCCTTTGT
GCCACGGTATACCCCAAGCCGGCCATTCTCCGTATGAGTGACTTCAAGACAAACGAGTATGCTGGCCTCATCGGC
GGTTCTCAGTTTGAGCCGAAAGAGGAGAACCCAATGCTTGGCTTCCGCGGGGCCTCACGCTACTATTCACCGCTG
TACAAAGAGGGGTTCGAGCTTGAATGTCGCGCCATCAAGAGGCTGCGCGAGGAGATGGGCTTCGCAAATGTCATT
GTTATGATCCCTTTCTGCCGGACAATTAGCGAGGCAAAAGAAGTACTAAAAACTATGTCCGAGAACGGGCTTAAA
CGTGGTGACAAGGGTCTCCAAGTATACGTCATGTGCGAGATACCTTCCAACGTCATCATGGCCAATGAATTCTCT
GAGTACTTCGATGGGTTCTCAATCGGTTCAAACGATCTGACACAACTGACGCTCGGTGTCGACCGCGACTCTGGT
GAGCTGGCAGGCCTCTTCAATGAGCAAGACGAGGCTGTCAAGTGGATGATTGCTCGGGTAATCATAGTTGCTCGC
AAGGCGGGTCGTAAGATTGGCATTTGCGGGCAGGCCCCAAGCGATCATCCGGAATTCGCCAAGTTCCTAGTGGAA
GCCGGTATCAACTCGATCTCGGTCAGCCCTGACAGCTTTGTCCAAGTGAAAAGACAAGTTCTTGAGAGTGAGAGG
AAACGACTTGATTTGATAGCGGACGAACATATCATGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail