Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8594.t1
Gene name
Locationscaffold_35:12814..14361
Strand+
Gene length (bp)1547
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 1.1E-25 39 434

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 39 58 19
2 68 90 22
3 120 142 22
4 152 169 17
5 176 198 22
6 225 247 22
7 260 282 22
8 306 328 22
9 340 362 22
10 372 394 22
11 415 437 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8594.t1
MTVKEKTSVNDAELGSPGDSTEEYEVFKKTEDGVSFRSVGWFKACIIFVKVLFATGVLSLPASLYSLGAVGGSIS
IVAWGAFNTYSFVILGNFRKKHPHCHSIADMAEVAGGFFAKELTGILFLIGYVLVTGSGIIGVSTALNALSHHAA
CTVWWSFIGAVVIIATASVRKLQHVGWLTYAGFISIYAAVLIVVIGVTTRDRPAAAPQEGPYELGYVAINNPGFA
AGMVASSTIFVSTAGTSAFIPVMSEMRNPKDYKKALYLCMVVVNASYLAFSLVVYRWCGQWVASPSLGSAGQTIK
MVSYGVALLGLVVSATIYLHIAAKYIFVRILGNTRHLQSNTVIHWVTWMSCTVGLGAISFILSETIPIFNYLVAL
IGSVCFAPLAMCLPGFLWLHSNGHYRKGTLMQKVIYLLHWGMVLLGIFFLVGATYGVIIQIIDAYATGMIGSTFS
CLDNSSSS*
Coding >Pro_DTO377G3_2|g8594.t1
ATGACCGTCAAAGAGAAGACAAGCGTAAATGACGCGGAGCTGGGAAGCCCTGGGGACTCTACCGAGGAGTACGAG
GTCTTCAAGAAAACCGAGGATGGCGTCAGCTTCCGCAGTGTTGGCTGGTTCAAGGCGTGCATTATCTTCGTGAAG
GTCCTCTTTGCGACGGGTGTGCTGTCGCTGCCAGCTTCACTGTACTCCCTCGGTGCGGTAGGTGGCTCGATCAGT
ATCGTCGCATGGGGCGCGTTCAACACCTACTCTTTCGTGATTCTGGGCAACTTCCGCAAGAAGCATCCTCACTGC
CACTCCATCGCCGATATGGCGGAAGTCGCCGGTGGTTTCTTCGCGAAAGAGCTTACCGGTATACTCTTCCTCATC
GGCTACGTCCTTGTCACGGGCAGTGGTATTATCGGAGTTTCAACGGCCTTGAATGCGCTTTCGCACCACGCTGCG
TGCACTGTCTGGTGGTCTTTCATTGGAGCGGTTGTGATCATCGCGACAGCTTCGGTACGCAAACTCCAGCATGTG
GGCTGGCTCACATATGCAGGATTCATTTCGATCTATGCCGCCGTTCTGATCGTTGTTATCGGAGTCACAACGCGC
GACCGGCCGGCTGCCGCACCCCAGGAGGGCCCTTACGAGCTCGGCTACGTGGCAATCAACAACCCCGGATTTGCG
GCTGGCATGGTCGCTTCCAGTACTATCTTCGTCTCTACGGCTGGTACCAGCGCCTTCATCCCGGTGATGTCGGAA
ATGCGAAACCCGAAGGACTACAAGAAGGCCCTATACCTGTGCATGGTTGTGGTTAATGCGTCGTACCTTGCTTTC
AGCTTGGTTGTGTATCGTTGGTGTGGACAATGGGTGGCTAGTCCGTCTTTGGGTAGCGCTGGACAGACGATCAAG
ATGGTATCTTACGGTGTTGCGCTGTTAGGACTGGTCGTCAGTGCCACGATCTACTTGCATATCGCCGCCAAATAC
ATATTTGTGCGTATCTTGGGTAACACGCGCCATCTGCAATCCAACACCGTCATTCATTGGGTTACTTGGATGAGC
TGTACGGTCGGTCTCGGTGCTATTTCCTTCATCCTCAGCGAGACTATCCCTATCTTCAACTACCTGGTTGCCCTA
ATTGGGTCCGTTTGCTTCGCGCCTCTGGCCATGTGCCTTCCCGGTTTCTTGTGGCTACACAGCAATGGTCATTAC
CGAAAGGGCACACTGATGCAGAAGGTTATCTACCTGCTGCACTGGGGAATGGTGCTCCTCGGAATTTTCTTCCTT
GTCGGCGCGACGTACGGTGTTATCATTCAGATCATCGATGCCTACGCAACGGGAATGATTGGCTCCACTTTCAGC
TGCTTGGACAACTCCAGCTCGTCGTAG
Transcript >Pro_DTO377G3_2|g8594.t1
ATGACCGTCAAAGAGAAGACAAGCGTAAATGACGCGGAGCTGGGAAGCCCTGGGGACTCTACCGAGGAGTACGAG
GTCTTCAAGAAAACCGAGGATGGCGTCAGCTTCCGCAGTGTTGGCTGGTTCAAGGCGTGCATTATCTTCGTGAAG
GTCCTCTTTGCGACGGGTGTGCTGTCGCTGCCAGCTTCACTGTACTCCCTCGGTGCGGTAGGTGGCTCGATCAGT
ATCGTCGCATGGGGCGCGTTCAACACCTACTCTTTCGTGATTCTGGGCAACTTCCGCAAGAAGCATCCTCACTGC
CACTCCATCGCCGATATGGCGGAAGTCGCCGGTGGTTTCTTCGCGAAAGAGCTTACCGGTATACTCTTCCTCATC
GGCTACGTCCTTGTCACGGGCAGTGGTATTATCGGAGTTTCAACGGCCTTGAATGCGCTTTCGCACCACGCTGCG
TGCACTGTCTGGTGGTCTTTCATTGGAGCGGTTGTGATCATCGCGACAGCTTCGGTACGCAAACTCCAGCATGTG
GGCTGGCTCACATATGCAGGATTCATTTCGATCTATGCCGCCGTTCTGATCGTTGTTATCGGAGTCACAACGCGC
GACCGGCCGGCTGCCGCACCCCAGGAGGGCCCTTACGAGCTCGGCTACGTGGCAATCAACAACCCCGGATTTGCG
GCTGGCATGGTCGCTTCCAGTACTATCTTCGTCTCTACGGCTGGTACCAGCGCCTTCATCCCGGTGATGTCGGAA
ATGCGAAACCCGAAGGACTACAAGAAGGCCCTATACCTGTGCATGGTTGTGGTTAATGCGTCGTACCTTGCTTTC
AGCTTGGTTGTGTATCGTTGGTGTGGACAATGGGTGGCTAGTCCGTCTTTGGGTAGCGCTGGACAGACGATCAAG
ATGGTATCTTACGGTGTTGCGCTGTTAGGACTGGTCGTCAGTGCCACGATCTACTTGCATATCGCCGCCAAATAC
ATATTTGTGCGTATCTTGGGTAACACGCGCCATCTGCAATCCAACACCGTCATTCATTGGGTTACTTGGATGAGC
TGTACGGTCGGTCTCGGTGCTATTTCCTTCATCCTCAGCGAGACTATCCCTATCTTCAACTACCTGGTTGCCCTA
ATTGGGTCCGTTTGCTTCGCGCCTCTGGCCATGTGCCTTCCCGGTTTCTTGTGGCTACACAGCAATGGTCATTAC
CGAAAGGGCACACTGATGCAGAAGGTTATCTACCTGCTGCACTGGGGAATGGTGCTCCTCGGAATTTTCTTCCTT
GTCGGCGCGACGTACGGTGTTATCATTCAGATCATCGATGCCTACGCAACGGGAATGATTGGCTCCACTTTCAGC
TGCTTGGACAACTCCAGCTCGTCGTAG
Gene >Pro_DTO377G3_2|g8594.t1
ATGACCGTCAAAGAGAAGACAAGCGTAAATGACGCGGAGCTGGGAAGCCCTGGGGACTCTACCGAGGAGTACGAG
GTCTTCAAGAAAACCGAGGATGGCGTCAGCTTCCGCAGTGTTGGCTGGTTCAAGGCGTGCATTATCTTCGTGAAG
GTCCTCTTTGCGACGGGTGTGCTGTCGCTGCCAGCTTCACTGTACTCCCTCGGTGCGGTAGGTGGCTCGATCAGT
ATCGTCGCATGGGGCGCGTTCAACACCTACTCTTTCGTGATTCTGGGCAACTTCCGCAAGAAGCATCCTCACTGC
CACTCCATCGCCGATATGGCGGAAGTCGCCGGTGGTTTCTTCGCGAAAGAGCTTACCGGTATACTCTTCCTCATC
GGCTACGTCCTTGTCACGGGCAGTGGTATTATCGGAGTTTCAACGGCCTTGAATGCGCTTTCGCACCACGCTGCG
TGCACTGTCTGGTGGTCTTTCATTGGAGCGGTTGTGATCATCGCGACAGCTTCGGTACGCAAACTCCAGCATGTG
GGCTGGCTCACATATGCAGGATTCATTTCGATCTATGCCGCCGTTCTGATCGTTGTTATCGGAGTCACAACGCGC
GACCGGCCGGCTGCCGCACCCCAGGAGGGCCCTTACGAGCTCGGCTACGTGGCAATCAACAACCCCGGATTTGCG
GCTGGCATGGTCGCTTCCAGTACTATCTTCGTCTCTACGGCTGGTACCAGCGCCTTCATCCCGGTGATGTCGGAA
ATGCGAAACCCGAAGGACTACAAGAAGGCCCTATACCTGTGCATGGTTGTGGTTAATGCGTCGTACCTTGCTTTC
AGCTTGGTTGTGTATCGTTGGTGTGGACAATGGGTGGCTAGTCCGTCTTTGGGTGTATGTATCCTATCCTTTGCC
TGATACCGGTTTCAGACAATCAGCTAATTTTTGATTTTTACAGAGCGCTGGACAGACGATCAAGATGGTATCTTA
CGGTGTTGCGCTGTTAGGACTGGTCGTCAGTGCCACGATCTACTTGCATGTGAGTATATCCCTCGCAACTCACGC
TTCCGGAACTGACTTCGCTACTTAGATCGCCGCCAAATACATATTTGTGCGTATCTTGGGTAACACGCGCCATCT
GCAATCCAACACCGTCATTCATTGGGTTACTTGGATGAGCTGTACGGTCGGTCTCGGTGCTATTTCCTTCATCCT
CAGCGAGACTATCCCTATCTTCAACTACCTGGTTGCCCTAATTGGGTCCGTTTGCTTCGCGCCTCTGGCCATGTG
CCTTCCCGGTTTCTTGTGGCTACACAGCAATGGTCATTACCGAAAGGGCACACTGATGCAGAAGGTTATCTACCT
GCTGCACTGGGGAATGGTGCTCCTCGGAATTTTCTTCCTTGTCGGCGCGACGTACGGTGTTATCATTCAGATCAT
CGATGCCTACGCAACGGGAATGATTGGTATGTTCTGCTATACCCGCAACAGTGTAGAACTGCGACTGACTTTTTT
TATTAGGCTCCACTTTCAGCTGCTTGGACAACTCCAGCTCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail