Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8586.t1
Gene name
Locationscaffold_34:227977..229998
Strand-
Gene length (bp)2021
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00809 Pterin_bind Pterin binding enzyme 2.2E-81 299 551
PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) 1.9E-34 119 246

GO

GO Term Description Terminal node
GO:0009396 folic acid-containing compound biosynthetic process Yes
GO:0042558 pteridine-containing compound metabolic process Yes
GO:0003848 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity Yes
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006760 folic acid-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016740 transferase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0042559 pteridine-containing compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016778 diphosphotransferase activity No
GO:0044237 cellular metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0009987 cellular process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 67.86 41.50 94.22
5d_25C Five days - 25 degrees Celsius 145.32 86.63 204.02
7d_25C Seven days - 25 degrees Celsius 195.80 115.18 276.42
10d_25C Ten days - 25 degrees Celsius 306.90 174.37 439.43
7d_15C Seven days - 15 degrees Celsius 140.65 82.63 198.68
7d_30C Seven days - 30 degrees Celsius 92.31 55.77 128.85

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.156245 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.207590 no
5d_25C 7d_15C 0.924821 no
5d_25C 7d_30C 0.033253 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.157727 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.047134 yes
7d_15C 7d_30C 0.050710 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8586.t1
MNARVIQRAPPLASLLPHTRQIGRSLRLSPLAAGPARSGHRPLHTGNRKPSPQSLGSTSQSQSVYTAQLASGILT
RNGLSRRSITSLHLTPPVRNLSTAQAVDSRMNLKFPSPDIHRAFIALGSNVGDRVEMIEQACLEMDRVGIKVKRT
SSLFETAPMYVLDQDTFINGVCEVETTLAPLDLLDTIQSIEIAMGRKKLIDKGPRSIDLDILLYDEEIVCHERLN
IPHNLMLERDFVLRPLSQLIPNEYPPLPGKDTQTYSTHLKALSPPDPTPMSTTPISPLFPSLRATDPKRSTHVMA
ILNLTPDSFSDGGKHSPTDLNYITETVRNFIASGATIIDIGGESTRPGSKPVGAAEEIARVVPAIKHIRTAIPEA
ANIAISIDTYRASVAEAACAAGADIINDISAGLLDPEMLPTVARIGKSVILMHMRGTPQTMTTLHEYPTGVIPEV
AAELGARIAAAEDAGIRRWRIILDPGLGFAKIQEHDLEILRDLPRLRAMPGLECFPWLMGPSRKRFIGHLTGVKT
PRERVWGTAATVSASVAGGADIVRVHDVHEMWQVAKVADAIYRVD*
Coding >Pro_DTO377G3_2|g8586.t1
ATGAATGCCAGGGTAATCCAGAGAGCCCCTCCATTGGCATCTCTTCTTCCTCATACACGGCAAATTGGGAGGTCG
CTAAGACTTTCGCCATTGGCTGCAGGTCCGGCCAGGAGTGGTCATAGACCGTTGCATACAGGTAACAGAAAACCC
TCACCGCAGAGCCTGGGGTCAACTTCTCAATCTCAATCGGTATATACAGCCCAATTGGCATCGGGAATTCTCACT
AGAAATGGTCTATCACGACGTTCAATAACGTCGTTGCATTTGACCCCGCCTGTGAGGAATTTATCCACTGCGCAA
GCAGTTGACTCCAGGATGAATTTGAAGTTTCCCAGTCCAGACATCCACCGGGCTTTTATTGCCCTAGGAAGCAAT
GTCGGAGACCGAGTAGAAATGATTGAGCAGGCTTGTCTTGAAATGGACCGAGTTGGTATCAAAGTGAAAAGGACA
AGTTCATTGTTCGAAACCGCACCGATGTATGTGCTTGATCAAGATACCTTCATCAATGGTGTATGCGAGGTGGAA
ACAACCCTTGCACCTTTGGATCTTTTGGACACTATTCAATCTATTGAGATTGCGATGGGCAGAAAGAAGCTCATC
GACAAAGGTCCACGCTCTATTGATCTGGATATCCTACTATATGATGAGGAGATCGTCTGTCATGAGCGTCTCAAC
ATCCCACACAATCTGATGCTTGAGCGAGACTTTGTATTGCGACCTCTTAGCCAATTAATCCCAAATGAATACCCT
CCACTACCAGGAAAGGACACGCAAACATACAGCACCCATCTGAAGGCTCTCTCGCCGCCAGATCCAACACCAATG
TCGACAACCCCAATCTCACCACTATTCCCATCCTTGCGCGCAACGGATCCCAAGCGCAGCACCCACGTCATGGCA
ATCCTCAATCTAACGCCAGACTCCTTCTCCGACGGCGGCAAGCACTCCCCAACCGACCTAAACTACATAACAGAA
ACAGTACGCAACTTCATCGCCTCCGGCGCAACAATAATCGACATCGGCGGTGAGAGCACCCGCCCAGGCTCAAAA
CCAGTCGGCGCCGCCGAAGAGATCGCCCGCGTAGTGCCAGCAATCAAGCACATCCGAACCGCCATTCCAGAAGCC
GCCAACATCGCCATCAGCATCGACACCTACCGCGCCAGCGTAGCAGAAGCCGCCTGCGCCGCCGGCGCAGACATC
ATCAACGACATTTCAGCCGGCCTCCTCGACCCAGAAATGCTACCAACAGTAGCGCGGATCGGTAAGTCCGTGATC
CTGATGCACATGCGCGGTACGCCGCAAACGATGACGACCCTACACGAGTACCCGACCGGCGTTATCCCGGAAGTA
GCTGCTGAGCTGGGCGCGCGCATTGCGGCTGCCGAAGACGCGGGGATCCGGCGCTGGCGCATCATCCTCGATCCG
GGTCTTGGCTTTGCGAAGATTCAGGAGCATGATCTGGAGATATTGCGGGACCTGCCTAGGCTGCGGGCGATGCCG
GGGCTCGAGTGCTTCCCTTGGTTGATGGGGCCTAGTCGGAAGAGATTTATTGGCCATCTTACTGGGGTCAAGACG
CCGCGGGAGCGCGTTTGGGGTACCGCTGCTACTGTCTCTGCTAGCGTGGCTGGTGGCGCGGACATTGTTCGTGTT
CATGATGTCCATGAGATGTGGCAGGTGGCGAAGGTTGCCGATGCGATTTATCGCGTTGATTGA
Transcript >Pro_DTO377G3_2|g8586.t1
ATGAATGCCAGGGTAATCCAGAGAGCCCCTCCATTGGCATCTCTTCTTCCTCATACACGGCAAATTGGGAGGTCG
CTAAGACTTTCGCCATTGGCTGCAGGTCCGGCCAGGAGTGGTCATAGACCGTTGCATACAGGTAACAGAAAACCC
TCACCGCAGAGCCTGGGGTCAACTTCTCAATCTCAATCGGTATATACAGCCCAATTGGCATCGGGAATTCTCACT
AGAAATGGTCTATCACGACGTTCAATAACGTCGTTGCATTTGACCCCGCCTGTGAGGAATTTATCCACTGCGCAA
GCAGTTGACTCCAGGATGAATTTGAAGTTTCCCAGTCCAGACATCCACCGGGCTTTTATTGCCCTAGGAAGCAAT
GTCGGAGACCGAGTAGAAATGATTGAGCAGGCTTGTCTTGAAATGGACCGAGTTGGTATCAAAGTGAAAAGGACA
AGTTCATTGTTCGAAACCGCACCGATGTATGTGCTTGATCAAGATACCTTCATCAATGGTGTATGCGAGGTGGAA
ACAACCCTTGCACCTTTGGATCTTTTGGACACTATTCAATCTATTGAGATTGCGATGGGCAGAAAGAAGCTCATC
GACAAAGGTCCACGCTCTATTGATCTGGATATCCTACTATATGATGAGGAGATCGTCTGTCATGAGCGTCTCAAC
ATCCCACACAATCTGATGCTTGAGCGAGACTTTGTATTGCGACCTCTTAGCCAATTAATCCCAAATGAATACCCT
CCACTACCAGGAAAGGACACGCAAACATACAGCACCCATCTGAAGGCTCTCTCGCCGCCAGATCCAACACCAATG
TCGACAACCCCAATCTCACCACTATTCCCATCCTTGCGCGCAACGGATCCCAAGCGCAGCACCCACGTCATGGCA
ATCCTCAATCTAACGCCAGACTCCTTCTCCGACGGCGGCAAGCACTCCCCAACCGACCTAAACTACATAACAGAA
ACAGTACGCAACTTCATCGCCTCCGGCGCAACAATAATCGACATCGGCGGTGAGAGCACCCGCCCAGGCTCAAAA
CCAGTCGGCGCCGCCGAAGAGATCGCCCGCGTAGTGCCAGCAATCAAGCACATCCGAACCGCCATTCCAGAAGCC
GCCAACATCGCCATCAGCATCGACACCTACCGCGCCAGCGTAGCAGAAGCCGCCTGCGCCGCCGGCGCAGACATC
ATCAACGACATTTCAGCCGGCCTCCTCGACCCAGAAATGCTACCAACAGTAGCGCGGATCGGTAAGTCCGTGATC
CTGATGCACATGCGCGGTACGCCGCAAACGATGACGACCCTACACGAGTACCCGACCGGCGTTATCCCGGAAGTA
GCTGCTGAGCTGGGCGCGCGCATTGCGGCTGCCGAAGACGCGGGGATCCGGCGCTGGCGCATCATCCTCGATCCG
GGTCTTGGCTTTGCGAAGATTCAGGAGCATGATCTGGAGATATTGCGGGACCTGCCTAGGCTGCGGGCGATGCCG
GGGCTCGAGTGCTTCCCTTGGTTGATGGGGCCTAGTCGGAAGAGATTTATTGGCCATCTTACTGGGGTCAAGACG
CCGCGGGAGCGCGTTTGGGGTACCGCTGCTACTGTCTCTGCTAGCGTGGCTGGTGGCGCGGACATTGTTCGTGTT
CATGATGTCCATGAGATGTGGCAGGTGGCGAAGGTTGCCGATGCGATTTATCGCGTTGATTGA
Gene >Pro_DTO377G3_2|g8586.t1
ATGAATGCCAGGGTAATCCAGAGAGCCCCTCCATTGGCATCTCTTCTTCCTCATACACGGCAAATTGGGAGGTCG
CTAAGACTTTCGCCATTGGCTGCAGGTCCGGCCAGGAGTGGTCATAGACCGTTGCATACAGGGTAAAGCCCCAAA
TAACCAATTAACTGTGGCGAATCTGACGACATCTTATAGTAACAGAAAACCCTCACCGCAGAGCCTGGGTATGTG
GCTAGCTACTTCTTAAAAGCCCCTCGCACGCTTATCGGCGTATCGTCCCAATGGGGAAATATGCCTGTCCCCGCA
AATTTTTTTTATTTGCCATGTCTCTACTTTATTGCAACACTAATATTCAATAGGGTCAACTTCTCAATCTCAATC
GGTATATACAGCCCAATTGGCATCGGGAATTCTCACTAGAAATGGTCTATCACGACGTTCAATAACGTCGTTGCA
TTTGACCCCGCCTGTGAGGAATTTATCCACTGCGCAAGCAGTTGACTCCAGGATGAATTTGAAGTTTCCCAGTCC
AGACATCCACCGGGCTTTTATTGCCCTAGGAAGCAATGTCGGAGACCGAGTAGAAATGATTGAGCAGGCTTGTCT
TGAAATGGACCGAGTTGGTATCAAAGTGAAAAGGACAAGTTCATTGTTCGAAACCGCACCGATGTATGTGCTTGA
TCAAGATACCTTCATCAATGGTGTATGCGAGGTATGTTAGCGAAAGTAATGTCCAAACTGGTAGCCCATTGTTAA
TTTCTATCAGGTGGAAACAACCCTTGCACCTTTGGATCTTTTGGACACTATTCAATCTATTGAGATTGCGATGGG
CAGAAAGAAGCTCATCGACAAAGGTCCACGCTCTATTGATCTGGATATCCTACTATATGATGAGGAGATCGTCTG
TCATGAGCGTCTCAACATCCCACACAATCTGATGCTTGAGCGAGACTTTGTATTGCGACCTCTTAGCCAGTACGC
TCCCAATGGCTTTATATATGCTATACCGACACAATAAGCAAAACTAACCATCTGAATTTAGATTAATCCCAAATG
AATACCCTCCACTACCAGGAAAGGACACGCAAACATACAGCACCCATCTGAAGGCTCTCTCGCCGCCAGATCCAA
CACCAATGTCGACAACCCCAATCTCACCACTATTCCCATCCTTGCGCGCAACGGATCCCAAGCGCAGCACCCACG
TCATGGCAATCCTCAATCTAACGCCAGACTCCTTCTCCGACGGCGGCAAGCACTCCCCAACCGACCTAAACTACA
TAACAGAAACAGTACGCAACTTCATCGCCTCCGGCGCAACAATAATCGACATCGGCGGTGAGAGCACCCGCCCAG
GCTCAAAACCAGTCGGCGCCGCCGAAGAGATCGCCCGCGTAGTGCCAGCAATCAAGCACATCCGAACCGCCATTC
CAGAAGCCGCCAACATCGCCATCAGCATCGACACCTACCGCGCCAGCGTAGCAGAAGCCGCCTGCGCCGCCGGCG
CAGACATCATCAACGACATTTCAGCCGGCCTCCTCGACCCAGAAATGCTACCAACAGTAGCGCGGATCGGTAAGT
CCGTGATCCTGATGCACATGCGCGGTACGCCGCAAACGATGACGACCCTACACGAGTACCCGACCGGCGTTATCC
CGGAAGTAGCTGCTGAGCTGGGCGCGCGCATTGCGGCTGCCGAAGACGCGGGGATCCGGCGCTGGCGCATCATCC
TCGATCCGGGTCTTGGCTTTGCGAAGATTCAGGAGCATGATCTGGAGATATTGCGGGACCTGCCTAGGCTGCGGG
CGATGCCGGGGCTCGAGTGCTTCCCTTGGTTGATGGGGCCTAGTCGGAAGAGATTTATTGGCCATCTTACTGGGG
TCAAGACGCCGCGGGAGCGCGTTTGGGGTACCGCTGCTACTGTCTCTGCTAGCGTGGCTGGTGGCGCGGACATTG
TTCGTGTTCATGATGTCCATGAGATGTGGCAGGTGGCGAAGGTTGCCGATGCGATTTATCGCGTTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail