Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8580.t1
Gene name
Locationscaffold_34:214998..216343
Strand-
Gene length (bp)1345
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 306 323 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 32.42 17.02 47.81
5d_25C Five days - 25 degrees Celsius 24.25 11.98 36.53
7d_25C Seven days - 25 degrees Celsius 26.01 12.87 39.15
10d_25C Ten days - 25 degrees Celsius 20.10 9.39 30.82
7d_15C Seven days - 15 degrees Celsius 24.59 11.43 37.76
7d_30C Seven days - 30 degrees Celsius 35.40 18.97 51.83

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.334809 no
3d_25C 7d_25C 0.491109 no
3d_25C 7d_15C 0.382028 no
3d_25C 7d_30C 0.811879 no
3d_25C 10d_25C 0.091039 no
5d_25C 7d_25C 0.862021 no
5d_25C 7d_15C 0.977493 no
5d_25C 7d_30C 0.163055 no
5d_25C 10d_25C 0.599006 no
7d_25C 7d_15C 0.898170 no
7d_25C 7d_30C 0.280529 no
7d_25C 10d_25C 0.439022 no
7d_15C 7d_30C 0.207685 no
7d_15C 10d_25C 0.582647 no
7d_30C 10d_25C 0.034125 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8580.t1
MSLLRQLSPSSAAVALLSLTGALWPTNALAGSTNDNSDGYKLREDIPVSCLNRTMEGEHVTDNLGKLQYVPFVTC
NETARPLSLHYGISETITCTIDSLSDEMYHLLEFYVHSDVPMSCRVPTAPLTPSTSAEHADKDSDQKSGEADTLS
ALADNGPPFTPLTIALQGTLQLSHLHIWTDMNVVMHNMASDAAAEQNTKTRGGQSLQPGFVVGGVAYSTPEFDNT
GKNAKLDEDEEPVALAQAAREPWTAGHGTKVVRGEPLTFSFHVAWLEGGASIGWPVRPALESWLALATGSGKSSG
SFFSKLVFFVMAASVGALVALFWERNGGRWRGRSAWHGDGLLGATPVRGAKSPGVTFGNGGKNNGYGGYSGPTIG
NGNGNGLGSGYVLPTGKRD*
Coding >Pro_DTO377G3_2|g8580.t1
ATGTCTCTTTTACGTCAATTGAGCCCGTCTTCCGCAGCAGTAGCGCTGCTGTCTTTGACAGGCGCATTGTGGCCA
ACCAACGCACTTGCGGGGAGCACCAATGACAACAGCGACGGATACAAATTGAGAGAGGATATCCCAGTGTCATGT
CTGAATCGAACCATGGAAGGAGAACATGTCACTGACAATCTCGGCAAACTCCAATACGTCCCCTTCGTGACCTGC
AACGAAACCGCCCGCCCTCTCTCTCTCCACTACGGCATATCTGAAACAATAACATGCACCATCGACTCCCTCTCC
GATGAGATGTACCACCTCCTCGAGTTCTACGTCCATTCGGATGTACCAATGAGCTGCCGCGTGCCAACAGCGCCG
CTGACACCATCCACCAGCGCAGAGCACGCGGACAAAGACTCGGACCAGAAGTCAGGCGAAGCAGACACCCTCTCC
GCACTAGCCGACAACGGGCCACCCTTCACGCCTCTCACAATCGCGCTGCAGGGCACACTCCAACTGAGCCATTTG
CACATCTGGACGGATATGAACGTCGTAATGCACAACATGGCCTCGGACGCGGCTGCAGAACAAAACACCAAAACT
CGCGGTGGTCAGTCTCTGCAGCCTGGCTTCGTGGTTGGCGGTGTTGCATACTCGACTCCCGAGTTCGACAACACC
GGCAAGAATGCCAAGCTCGACGAGGACGAGGAGCCTGTTGCCCTTGCTCAGGCGGCACGCGAGCCGTGGACTGCT
GGGCATGGCACTAAGGTTGTGCGTGGGGAGCCGCTTACCTTCTCTTTCCACGTTGCATGGTTGGAGGGCGGTGCC
AGTATTGGGTGGCCGGTGCGGCCTGCTTTGGAATCGTGGCTGGCTTTGGCGACTGGGTCTGGGAAGAGCTCTGGG
TCTTTCTTTTCCAAGCTGGTGTTCTTTGTTATGGCGGCCTCTGTTGGCGCTTTAGTTGCGCTTTTCTGGGAGCGC
AATGGTGGGCGTTGGCGTGGGCGATCCGCTTGGCATGGAGATGGGCTTTTGGGTGCGACCCCCGTCCGTGGAGCG
AAGAGTCCTGGTGTTACCTTTGGCAATGGGGGGAAGAACAATGGCTATGGTGGTTACTCCGGCCCTACTATTGGC
AATGGCAATGGGAACGGGCTTGGAAGTGGATATGTCTTGCCAACTGGAAAGAGGGATTAA
Transcript >Pro_DTO377G3_2|g8580.t1
ATGTCTCTTTTACGTCAATTGAGCCCGTCTTCCGCAGCAGTAGCGCTGCTGTCTTTGACAGGCGCATTGTGGCCA
ACCAACGCACTTGCGGGGAGCACCAATGACAACAGCGACGGATACAAATTGAGAGAGGATATCCCAGTGTCATGT
CTGAATCGAACCATGGAAGGAGAACATGTCACTGACAATCTCGGCAAACTCCAATACGTCCCCTTCGTGACCTGC
AACGAAACCGCCCGCCCTCTCTCTCTCCACTACGGCATATCTGAAACAATAACATGCACCATCGACTCCCTCTCC
GATGAGATGTACCACCTCCTCGAGTTCTACGTCCATTCGGATGTACCAATGAGCTGCCGCGTGCCAACAGCGCCG
CTGACACCATCCACCAGCGCAGAGCACGCGGACAAAGACTCGGACCAGAAGTCAGGCGAAGCAGACACCCTCTCC
GCACTAGCCGACAACGGGCCACCCTTCACGCCTCTCACAATCGCGCTGCAGGGCACACTCCAACTGAGCCATTTG
CACATCTGGACGGATATGAACGTCGTAATGCACAACATGGCCTCGGACGCGGCTGCAGAACAAAACACCAAAACT
CGCGGTGGTCAGTCTCTGCAGCCTGGCTTCGTGGTTGGCGGTGTTGCATACTCGACTCCCGAGTTCGACAACACC
GGCAAGAATGCCAAGCTCGACGAGGACGAGGAGCCTGTTGCCCTTGCTCAGGCGGCACGCGAGCCGTGGACTGCT
GGGCATGGCACTAAGGTTGTGCGTGGGGAGCCGCTTACCTTCTCTTTCCACGTTGCATGGTTGGAGGGCGGTGCC
AGTATTGGGTGGCCGGTGCGGCCTGCTTTGGAATCGTGGCTGGCTTTGGCGACTGGGTCTGGGAAGAGCTCTGGG
TCTTTCTTTTCCAAGCTGGTGTTCTTTGTTATGGCGGCCTCTGTTGGCGCTTTAGTTGCGCTTTTCTGGGAGCGC
AATGGTGGGCGTTGGCGTGGGCGATCCGCTTGGCATGGAGATGGGCTTTTGGGTGCGACCCCCGTCCGTGGAGCG
AAGAGTCCTGGTGTTACCTTTGGCAATGGGGGGAAGAACAATGGCTATGGTGGTTACTCCGGCCCTACTATTGGC
AATGGCAATGGGAACGGGCTTGGAAGTGGATATGTCTTGCCAACTGGAAAGAGGGATTAA
Gene >Pro_DTO377G3_2|g8580.t1
ATGTCTCTTTTACGTCAATTGAGCCCGTCTTCCGCAGCAGTAGCGCTGCTGTCTTTGACAGGCGCATTGTGGCCA
ACCAACGCACTTGCGGGGAGCACCAATGACAACAGCGACGGATACAAATTGAGAGAGGATATCCCAGTGTCATGT
CTGAATCGAACCATGTGAGACCACTCTTCAATCAAGCTGTAGAGTACGGCTAACCATTGCTCGTTCTACACCTGC
AGGGAAGGAGAACATGTAAGCGCCACCAGTCTGCCTACCGTCTCCTGACACGAAGACAATAGCGCAGACTACCAG
GAAACACAAAGCTAATAGCAACTACGAAAACATCCAGGTCACTGACAATCTCGGCAAACTCCAATACGTCCCCTT
CGTGACCTGCAACGAAACCGCCCGCCCTCTCTCTCTCCACTACGGCATATCTGAAACAATAACATGCACCATCGA
CTCCCTCTCCGATGAGATGTACCACCTCCTCGAGTTCTACGTCCATTCGGATGTACCAATGAGCTGCCGCGTGCC
AACAGCGCCGCTGACACCATCCACCAGCGCAGAGCACGCGGACAAAGACTCGGACCAGAAGTCAGGCGAAGCAGA
CACCCTCTCCGCACTAGCCGACAACGGGCCACCCTTCACGCCTCTCACAATCGCGCTGCAGGGCACACTCCAACT
GAGCCATTTGCACATCTGGACGGATATGAACGTCGTAATGCACAACATGGCCTCGGACGCGGCTGCAGAACAAAA
CACCAAAACTCGCGGTGGTCAGTCTCTGCAGCCTGGCTTCGTGGTTGGCGGTGTTGCATACTCGACTCCCGAGTT
CGACAACACCGGCAAGAATGCCAAGCTCGACGAGGACGAGGAGCCTGTTGCCCTTGCTCAGGCGGCACGCGAGCC
GTGGACTGCTGGGCATGGCACTAAGGTTGTGCGTGGGGAGCCGCTTACCTTCTCTTTCCACGTTGCATGGTTGGA
GGGCGGTGCCAGTATTGGGTGGCCGGTGCGGCCTGCTTTGGAATCGTGGCTGGCTTTGGCGACTGGGTCTGGGAA
GAGCTCTGGGTCTTTCTTTTCCAAGCTGGTGTTCTTTGTTATGGCGGCCTCTGTTGGCGCTTTAGTTGCGCTTTT
CTGGGAGCGCAATGGTGGGCGTTGGCGTGGGCGATCCGCTTGGCATGGAGATGGGCTTTTGGGTGCGACCCCCGT
CCGTGGAGCGAAGAGTCCTGGTGTTACCTTTGGCAATGGGGGGAAGAACAATGGCTATGGTGGTTACTCCGGCCC
TACTATTGGCAATGGCAATGGGAACGGGCTTGGAAGTGGATATGTCTTGCCAACTGGAAAGAGGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail