Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8571.t1
Gene name
Locationscaffold_34:195071..196021
Strand-
Gene length (bp)950
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00403 HMA Heavy-metal-associated domain 5.0E-13 8 65
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC) 1.1E-07 94 202

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0006801 superoxide metabolic process Yes
GO:0008150 biological_process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0072593 reactive oxygen species metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 99.03 58.16 139.89
5d_25C Five days - 25 degrees Celsius 135.77 81.39 190.14
7d_25C Seven days - 25 degrees Celsius 166.68 100.80 232.57
10d_25C Ten days - 25 degrees Celsius 219.41 133.76 305.06
7d_15C Seven days - 15 degrees Celsius 131.24 78.86 183.62
7d_30C Seven days - 30 degrees Celsius 137.01 82.04 191.97

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.175760 no
3d_25C 7d_25C 0.011688 yes
3d_25C 7d_15C 0.232845 no
3d_25C 7d_30C 0.155898 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.411808 no
5d_25C 7d_15C 0.922153 no
5d_25C 7d_30C 0.981316 no
5d_25C 10d_25C 0.019886 yes
7d_25C 7d_15C 0.319022 no
7d_25C 7d_30C 0.435730 no
7d_25C 10d_25C 0.226265 no
7d_15C 7d_30C 0.900338 no
7d_15C 10d_25C 0.011993 yes
7d_30C 10d_25C 0.023429 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8571.t1
MIEPFQTTFSVPMTCEGCVNSISSSLNSLEGINKVEANLKDQLVFIEGTAPPSSIVSAIESTGRDAILRGSGTTN
SSAVCILETHSTTVSNNIRGLARMVQVSPNMTLIDLTINGLAPGKYWTTIREAGDISRGAESTGGIWESLKTKML
GADATVAPAKECRGILGTVDVDNKGRGSVFLDRPVAIWELIGRSMVVSKGTQGPFKREDENTLVGVIARSAGVWD
NDKMVCSCSGKNVWQERKEQVGLGMA*
Coding >Pro_DTO377G3_2|g8571.t1
ATGATTGAACCATTCCAGACGACCTTCTCGGTCCCAATGACATGTGAAGGCTGCGTGAATTCTATATCCAGCTCT
CTAAATAGCCTGGAAGGAATCAATAAAGTTGAAGCAAACCTTAAAGACCAGCTAGTCTTCATCGAAGGCACCGCC
CCTCCCAGCTCCATCGTAAGCGCGATTGAGAGCACCGGCCGCGATGCCATCCTCCGTGGTAGCGGTACTACCAAC
AGTTCCGCCGTATGTATCCTCGAAACACACTCAACGACCGTCTCCAACAACATCCGCGGACTCGCGCGCATGGTC
CAGGTCTCCCCGAACATGACCCTCATCGACCTGACAATCAACGGCCTCGCGCCGGGCAAATACTGGACAACTATC
CGTGAAGCGGGAGATATCTCCCGCGGTGCCGAGTCTACGGGTGGTATCTGGGAGTCTCTGAAGACCAAAATGCTT
GGCGCTGATGCTACTGTCGCCCCGGCCAAGGAGTGCCGGGGCATTCTCGGTACCGTGGATGTTGACAATAAGGGC
CGGGGTAGTGTGTTCTTGGACCGGCCTGTGGCAATCTGGGAGCTTATTGGCCGGAGTATGGTGGTTTCCAAGGGG
ACGCAGGGTCCTTTCAAGCGCGAGGATGAGAATACCCTTGTTGGTGTTATTGCGCGCAGTGCAGGTGTGTGGGAT
AATGATAAGATGGTTTGCTCGTGCTCGGGTAAGAATGTGTGGCAGGAGAGAAAGGAACAGGTTGGTTTGGGTATG
GCTTGA
Transcript >Pro_DTO377G3_2|g8571.t1
ATGATTGAACCATTCCAGACGACCTTCTCGGTCCCAATGACATGTGAAGGCTGCGTGAATTCTATATCCAGCTCT
CTAAATAGCCTGGAAGGAATCAATAAAGTTGAAGCAAACCTTAAAGACCAGCTAGTCTTCATCGAAGGCACCGCC
CCTCCCAGCTCCATCGTAAGCGCGATTGAGAGCACCGGCCGCGATGCCATCCTCCGTGGTAGCGGTACTACCAAC
AGTTCCGCCGTATGTATCCTCGAAACACACTCAACGACCGTCTCCAACAACATCCGCGGACTCGCGCGCATGGTC
CAGGTCTCCCCGAACATGACCCTCATCGACCTGACAATCAACGGCCTCGCGCCGGGCAAATACTGGACAACTATC
CGTGAAGCGGGAGATATCTCCCGCGGTGCCGAGTCTACGGGTGGTATCTGGGAGTCTCTGAAGACCAAAATGCTT
GGCGCTGATGCTACTGTCGCCCCGGCCAAGGAGTGCCGGGGCATTCTCGGTACCGTGGATGTTGACAATAAGGGC
CGGGGTAGTGTGTTCTTGGACCGGCCTGTGGCAATCTGGGAGCTTATTGGCCGGAGTATGGTGGTTTCCAAGGGG
ACGCAGGGTCCTTTCAAGCGCGAGGATGAGAATACCCTTGTTGGTGTTATTGCGCGCAGTGCAGGTGTGTGGGAT
AATGATAAGATGGTTTGCTCGTGCTCGGGTAAGAATGTGTGGCAGGAGAGAAAGGAACAGGTTGGTTTGGGTATG
GCTTGA
Gene >Pro_DTO377G3_2|g8571.t1
ATGATTGAACCATTCCAGGTCAGCCTTGTCTGAGCGACATGACTCACAAACAGCCAGTACTAATGCGGTTCCTAT
GTCTAGACGACCTTCTCGGTCCCAATGACATGTGAAGGCTGCGTGAATTCTATATCCAGCTCTCTAAATAGCCTG
GAAGGTAGTCATCTCACGCGAGCATCTAAACCTTCACGCAAACTGACCCCGCGGCAGGAATCAATAAAGTTGAAG
CAAACCTTAAAGACCAGCTAGTCTTCATCGAAGGCACCGCCCCTCCCAGCTCCATCGTAAGCGCGATTGAGAGCA
CCGGCCGCGATGCCATCCTCCGTGGTAGCGGTACTACCAACAGTATGGAATCCCCGGTGTCTACTTACTATCCCA
TGCGACATAAATGAGCAACCTCAATTGATACAAATTACCAAACAGGTTCCGCCGTATGTATCCTCGAAACACACT
CAACGACCGTCTCCAACAACATCCGCGGACTCGCGCGCATGGTCCAGGTCTCCCCGAACATGACCCTCATCGACC
TGACAATCAACGGCCTCGCGCCGGGCAAATACTGGACAACTATCCGTGAAGCGGGAGATATCTCCCGCGGTGCCG
AGTCTACGGGTGGTATCTGGGAGTCTCTGAAGACCAAAATGCTTGGCGCTGATGCTACTGTCGCCCCGGCCAAGG
AGTGCCGGGGCATTCTCGGTACCGTGGATGTTGACAATAAGGGCCGGGGTAGTGTGTTCTTGGACCGGCCTGTGG
CAATCTGGGAGCTTATTGGCCGGAGTATGGTGGTTTCCAAGGGGACGCAGGGTCCTTTCAAGCGCGAGGATGAGA
ATACCCTTGTTGGTGTTATTGCGCGCAGTGCAGGTGTGTGGGATAATGATAAGATGGTTTGCTCGTGCTCGGGTA
AGAATGTGTGGCAGGAGAGAAAGGAACAGGTTGGTTTGGGTATGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail