Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g856.t1
Gene name
Locationscaffold_01:2284571..2289449
Strand+
Gene length (bp)4878
Transcript length (bp)4083
Coding sequence length (bp)4083
Protein length (aa) 1361

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01967 MoaC MoaC family 2.7E-47 1207 1352
PF00005 ABC_tran ABC transporter 2.1E-18 68 310
PF00005 ABC_tran ABC transporter 1.1E-22 500 638
PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C 2.3E-36 985 1090
PF04055 Radical_SAM Radical SAM superfamily 2.3E-26 812 978
PF12848 ABC_tran_Xtn ABC transporter 4.0E-08 355 426
PF13353 Fer4_12 4Fe-4S single cluster domain 1.7E-04 816 905

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0006777 Mo-molybdopterin cofactor biosynthetic process Yes
GO:0005524 ATP binding Yes
GO:0051539 4 iron, 4 sulfur cluster binding Yes
GO:0019008 molybdopterin synthase complex Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0051540 metal cluster binding No
GO:0008152 metabolic process No
GO:0051189 prosthetic group metabolic process No
GO:0000166 nucleotide binding No
GO:0090407 organophosphate biosynthetic process No
GO:0030554 adenyl nucleotide binding No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0008150 biological_process No
GO:0017076 purine nucleotide binding No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0019720 Mo-molybdopterin cofactor metabolic process No
GO:0043167 ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0018130 heterocycle biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0044249 cellular biosynthetic process No
GO:0043545 molybdopterin cofactor metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0009058 biosynthetic process No
GO:0036094 small molecule binding No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g856.t1
MTSAPTILATCKQTRFHLLDDNPSQEIDVEGLNIIVTSSAPESTEDASKPKTKGKSRAKAAGRELISDAHLRLKA
GVHYGLLGRNGTGKSTLLRAMAEKLIPGIPHATRMAILQQTDQQDDVTFGEDPNQDKTVLEAVLSSDESRNEAVR
MTEFLSKSFETEDPMQPVRAIRKIRHQKAEKHLFLAHKNASLKSGARGLQARKDLKAAEGKLEAASEMLAQDVAA
IDAETVQSDTQAAVETLQNLQSQIEDMKLADMKQQARRVLLGLGFKEDGFEKKVSTLSGGWRMRCMLASVLVQDP
DIMILDEPTNFLDLLGVVWLENYLKQLRDTSETTIVLVSHDRDFINAVCEEIVILRDQKLTYFRGNLSAYEQDFE
EQKLYLGRMKEAQERQVAHMEASIRENMKIGKKTNDENKLRQAKSRQKKVDDRMGLQVSANGGRFKLNRDLVGWH
LHNRAEIDVPTDEKGATMSLPDATELRFPGPLVSLEGIVFQYKKTDRVILDDVNLVVHLGDRVGIMGLNGSGKTT
LLRILTGQVSPSKGKVSTHSRLKVGYYSQHSVEELQERGRGEPSLTALGLLTIETEGSLNEGAIRGLLSSMGLAG
RIASDVPVAKLSGGQLVRLALARIVWSAPQLLILDEITTHLDFHTVTALATALSSFNGAVLLISHDRFLVRSVIE
GKRDTEHKLDEDFEGLEEEETEETPRRRSVYVIKQGKMNEQKNGVEQFEKSLVKRNFLMAGLCKRILSCPRVARQ
WGIQTRLQSTRAASRSNATVVPELPPPHPATEASKPSKFKSTKPFSEFLTDTFNRQHDYLRISVTERCNLRCLYC
MPEEGIDLSPSAKLLTSPEILYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQDIGKLRQNGLRELCLTTNGISL
HRKLDSMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEMNKVGAGIKLKINCVVMRGMNDREILP
FVELGREKPIEVRFIEYMPFGGNKWNQEKMFSYQEMLAVIREKYPTFEKVADHKNDTSKTYRVPGFEGRVGFITS
MTHNFCGTCNRLRITSDGNLKVCLFGNSEVSLRDIIRKENGGSPIDVDAMNNLQLLETVQNAARLSDEGGLVNER
EREILDIIGMAVKRKKAKHAGMAQLKDMKNRPMILIASQSRLYHPGRSKPETTDCTSRPSPSLPTTSDTDLPHLT
PSKTVHMTQITEKPETKRVATAACTVSFSNARPWEILREGQTTHKGDVFSVARIAGIMAAKRTPDIVPLCHPGIG
ITGVEVSVELVGPAGDRDRDHGAMHVVASVSCFGRTGVEMEAMTATMGAALTVYDMLKAVDKGMVIDSVRLLEKQ
GGKSGHWVRE*
Coding >Pro_DTO377G3_2|g856.t1
ATGACATCGGCCCCGACAATTCTGGCTACGTGCAAGCAGACACGGTTTCATCTGCTAGATGATAATCCTTCGCAG
GAGATCGATGTGGAGGGACTTAACATCATAGTCACATCATCTGCACCTGAATCCACGGAAGATGCCTCAAAGCCA
AAGACCAAAGGAAAATCAAGGGCCAAGGCTGCGGGGAGAGAGCTCATATCAGACGCGCACCTACGACTCAAGGCA
GGCGTTCACTATGGGTTACTAGGTCGCAACGGAACTGGAAAGTCAACGCTGCTCCGGGCAATGGCCGAGAAACTC
ATTCCTGGCATCCCGCATGCGACTCGCATGGCTATTTTGCAGCAAACAGACCAGCAGGATGACGTTACATTCGGC
GAAGACCCTAATCAGGACAAAACTGTTTTGGAAGCCGTTCTCAGCAGCGATGAAAGTAGGAACGAGGCTGTTCGG
ATGACAGAATTTCTGTCGAAAAGTTTTGAGACTGAAGATCCAATGCAGCCCGTGCGGGCGATCCGTAAAATCCGG
CACCAGAAAGCAGAAAAGCATCTCTTCCTGGCTCACAAGAACGCAAGCCTGAAAAGCGGTGCTCGAGGTCTACAA
GCAAGAAAAGACCTGAAGGCTGCCGAGGGGAAGCTCGAGGCTGCATCGGAGATGTTGGCCCAGGATGTAGCCGCT
ATCGATGCGGAGACAGTCCAGTCGGATACCCAAGCTGCCGTTGAGACACTACAAAATTTACAGTCTCAAATCGAA
GACATGAAACTTGCTGATATGAAGCAACAAGCCCGTCGCGTTCTTCTTGGTCTCGGCTTTAAAGAAGACGGATTC
GAGAAGAAAGTCTCTACGCTCTCAGGTGGCTGGCGTATGCGATGTATGCTAGCCAGCGTTCTGGTCCAAGACCCC
GACATCATGATCCTAGATGAGCCGACCAACTTCCTCGATCTGCTAGGAGTAGTGTGGCTAGAGAATTACCTGAAA
CAACTCCGCGACACATCAGAAACAACCATCGTCTTGGTTTCACACGACAGAGATTTCATCAATGCTGTCTGCGAG
GAGATTGTCATTCTGCGAGATCAGAAATTGACTTATTTCCGAGGGAACCTGTCTGCATACGAGCAAGATTTCGAG
GAACAGAAGCTCTACCTAGGGCGCATGAAGGAGGCCCAAGAACGGCAGGTTGCGCATATGGAAGCTAGTATCCGG
GAGAATATGAAAATTGGAAAGAAGACCAATGACGAAAATAAGCTGCGACAAGCTAAGTCACGGCAGAAAAAGGTC
GATGACCGGATGGGTCTTCAAGTCAGCGCAAACGGGGGACGTTTCAAGCTGAACCGTGATCTAGTCGGATGGCAT
CTCCACAATCGGGCTGAGATCGACGTTCCGACAGATGAAAAGGGCGCGACTATGAGCTTGCCCGATGCGACGGAG
TTGCGGTTCCCTGGGCCGCTGGTATCGCTTGAGGGTATTGTCTTCCAGTACAAGAAAACCGACCGCGTCATCCTG
GATGACGTGAACTTGGTTGTTCACCTGGGTGATCGTGTCGGAATTATGGGTCTCAATGGATCGGGGAAAACAACG
CTGCTCCGTATTTTGACGGGACAGGTGTCTCCTTCCAAGGGCAAGGTGTCGACTCACTCCCGGTTGAAAGTGGGC
TACTATAGCCAACACTCCGTGGAAGAGCTGCAAGAACGTGGCCGAGGCGAGCCTAGCTTAACTGCGCTGGGCTTG
TTGACAATTGAGACTGAAGGATCGCTGAACGAGGGCGCTATCAGAGGTCTACTTTCTTCAATGGGGTTAGCGGGT
CGTATTGCATCTGATGTCCCTGTGGCCAAGCTGTCAGGCGGACAACTGGTCCGCCTTGCATTAGCTCGAATCGTC
TGGAGTGCACCACAACTTCTGATTCTTGATGAAATCACCACGCATTTGGATTTCCACACTGTCACTGCATTAGCT
ACGGCTCTCTCCTCCTTCAATGGCGCCGTGCTACTAATTTCACACGATCGTTTCCTTGTTCGGTCGGTAATTGAG
GGCAAGCGAGATACCGAGCATAAGCTTGATGAAGATTTCGAAGGGCTGGAGGAGGAAGAGACCGAAGAAACGCCA
AGGCGCCGGTCGGTCTATGTGATTAAACAAGGCAAGATGAACGAACAGAAGAATGGGGTGGAGCAGTTCGAAAAG
AGCCTGGTGAAGAGGAACTTCCTCATGGCTGGCTTGTGCAAGCGGATCTTGTCTTGCCCTAGGGTTGCCCGTCAG
TGGGGCATACAGACTCGACTTCAGAGCACTCGCGCCGCATCAAGATCTAACGCCACCGTCGTCCCTGAATTGCCT
CCTCCGCATCCCGCAACCGAGGCCTCCAAACCGTCAAAATTCAAGTCCACGAAGCCCTTCTCCGAATTCCTCACC
GATACCTTCAATCGGCAACATGACTATCTCCGCATTAGCGTCACGGAACGGTGCAATCTCCGGTGTCTGTATTGC
ATGCCCGAGGAAGGCATAGACCTCTCGCCCTCTGCGAAACTGCTTACATCCCCGGAGATCCTATACCTATCCTCG
CTATTCGTCTCACAAGGCGTGACCAAAATCCGATTGACTGGCGGAGAACCGACGGTCCGCAAGGACATCGTGCCA
TTGATGCAGGACATTGGCAAGCTGCGACAAAATGGGCTTCGGGAATTGTGTCTAACAACCAACGGAATCTCATTA
CATCGAAAATTGGACTCGATGGTGGAGGCTGGTTTGACGGGAGTCAATCTCAGCCTTGACACGCTGGATCCATTC
CAGTTCCAGATCATGACGAGACGCAAGGGATTCGATGCTGTGATGAAGAGCATCGACCGCATTCTGGAAATGAAT
AAGGTCGGTGCGGGGATCAAGTTGAAGATCAATTGTGTTGTTATGAGGGGAATGAACGACCGAGAGATCCTTCCG
TTCGTGGAGCTGGGCCGCGAGAAGCCGATTGAAGTGCGCTTCATCGAGTATATGCCTTTCGGTGGAAACAAATGG
AACCAGGAAAAGATGTTCTCATATCAGGAGATGCTGGCTGTTATCCGAGAGAAGTATCCCACGTTCGAAAAAGTG
GCCGACCACAAGAATGACACGAGTAAGACATACCGTGTTCCTGGCTTCGAGGGCCGCGTGGGATTTATCACGAGC
ATGACACACAACTTCTGTGGTACCTGCAACAGGCTACGTATTACTAGCGACGGAAATCTCAAAGTCTGTCTGTTC
GGTAACTCTGAAGTCTCCTTGCGGGATATCATTCGTAAGGAGAATGGTGGGAGCCCGATTGACGTGGATGCAATG
AACAACCTGCAGCTGTTGGAAACAGTACAAAACGCAGCGCGCCTTAGCGACGAAGGCGGCTTGGTGAATGAACGA
GAACGTGAGATTCTCGACATCATCGGCATGGCAGTGAAACGAAAGAAGGCGAAACACGCCGGCATGGCACAACTT
AAGGATATGAAGAACCGTCCTATGATCTTGATTGCTTCCCAAAGTCGTCTCTACCACCCCGGGCGCTCTAAGCCA
GAGACCACAGACTGTACTTCTCGTCCATCTCCCTCTCTACCCACCACCTCAGACACCGACCTCCCTCACCTTACA
CCATCCAAGACCGTACACATGACACAGATCACCGAAAAGCCCGAAACAAAGCGCGTCGCCACAGCCGCCTGCACC
GTCTCCTTCTCAAACGCCCGACCCTGGGAAATCCTCCGCGAAGGCCAAACCACGCACAAAGGCGACGTCTTCAGC
GTCGCCCGGATCGCGGGTATCATGGCCGCCAAAAGAACGCCTGATATTGTGCCCCTTTGCCATCCCGGCATTGGT
ATTACCGGAGTCGAGGTCAGCGTGGAACTCGTTGGGCCTGCGGGGGACAGGGACAGGGATCACGGCGCCATGCAT
GTCGTGGCGTCGGTCAGCTGCTTCGGTCGCACAGGCGTAGAAATGGAGGCTATGACGGCTACTATGGGTGCGGCT
TTGACGGTTTATGATATGCTCAAGGCTGTGGATAAGGGGATGGTCATTGATTCTGTCCGATTGTTGGAGAAACAG
GGTGGGAAGAGTGGGCATTGGGTACGGGAATGA
Transcript >Pro_DTO377G3_2|g856.t1
ATGACATCGGCCCCGACAATTCTGGCTACGTGCAAGCAGACACGGTTTCATCTGCTAGATGATAATCCTTCGCAG
GAGATCGATGTGGAGGGACTTAACATCATAGTCACATCATCTGCACCTGAATCCACGGAAGATGCCTCAAAGCCA
AAGACCAAAGGAAAATCAAGGGCCAAGGCTGCGGGGAGAGAGCTCATATCAGACGCGCACCTACGACTCAAGGCA
GGCGTTCACTATGGGTTACTAGGTCGCAACGGAACTGGAAAGTCAACGCTGCTCCGGGCAATGGCCGAGAAACTC
ATTCCTGGCATCCCGCATGCGACTCGCATGGCTATTTTGCAGCAAACAGACCAGCAGGATGACGTTACATTCGGC
GAAGACCCTAATCAGGACAAAACTGTTTTGGAAGCCGTTCTCAGCAGCGATGAAAGTAGGAACGAGGCTGTTCGG
ATGACAGAATTTCTGTCGAAAAGTTTTGAGACTGAAGATCCAATGCAGCCCGTGCGGGCGATCCGTAAAATCCGG
CACCAGAAAGCAGAAAAGCATCTCTTCCTGGCTCACAAGAACGCAAGCCTGAAAAGCGGTGCTCGAGGTCTACAA
GCAAGAAAAGACCTGAAGGCTGCCGAGGGGAAGCTCGAGGCTGCATCGGAGATGTTGGCCCAGGATGTAGCCGCT
ATCGATGCGGAGACAGTCCAGTCGGATACCCAAGCTGCCGTTGAGACACTACAAAATTTACAGTCTCAAATCGAA
GACATGAAACTTGCTGATATGAAGCAACAAGCCCGTCGCGTTCTTCTTGGTCTCGGCTTTAAAGAAGACGGATTC
GAGAAGAAAGTCTCTACGCTCTCAGGTGGCTGGCGTATGCGATGTATGCTAGCCAGCGTTCTGGTCCAAGACCCC
GACATCATGATCCTAGATGAGCCGACCAACTTCCTCGATCTGCTAGGAGTAGTGTGGCTAGAGAATTACCTGAAA
CAACTCCGCGACACATCAGAAACAACCATCGTCTTGGTTTCACACGACAGAGATTTCATCAATGCTGTCTGCGAG
GAGATTGTCATTCTGCGAGATCAGAAATTGACTTATTTCCGAGGGAACCTGTCTGCATACGAGCAAGATTTCGAG
GAACAGAAGCTCTACCTAGGGCGCATGAAGGAGGCCCAAGAACGGCAGGTTGCGCATATGGAAGCTAGTATCCGG
GAGAATATGAAAATTGGAAAGAAGACCAATGACGAAAATAAGCTGCGACAAGCTAAGTCACGGCAGAAAAAGGTC
GATGACCGGATGGGTCTTCAAGTCAGCGCAAACGGGGGACGTTTCAAGCTGAACCGTGATCTAGTCGGATGGCAT
CTCCACAATCGGGCTGAGATCGACGTTCCGACAGATGAAAAGGGCGCGACTATGAGCTTGCCCGATGCGACGGAG
TTGCGGTTCCCTGGGCCGCTGGTATCGCTTGAGGGTATTGTCTTCCAGTACAAGAAAACCGACCGCGTCATCCTG
GATGACGTGAACTTGGTTGTTCACCTGGGTGATCGTGTCGGAATTATGGGTCTCAATGGATCGGGGAAAACAACG
CTGCTCCGTATTTTGACGGGACAGGTGTCTCCTTCCAAGGGCAAGGTGTCGACTCACTCCCGGTTGAAAGTGGGC
TACTATAGCCAACACTCCGTGGAAGAGCTGCAAGAACGTGGCCGAGGCGAGCCTAGCTTAACTGCGCTGGGCTTG
TTGACAATTGAGACTGAAGGATCGCTGAACGAGGGCGCTATCAGAGGTCTACTTTCTTCAATGGGGTTAGCGGGT
CGTATTGCATCTGATGTCCCTGTGGCCAAGCTGTCAGGCGGACAACTGGTCCGCCTTGCATTAGCTCGAATCGTC
TGGAGTGCACCACAACTTCTGATTCTTGATGAAATCACCACGCATTTGGATTTCCACACTGTCACTGCATTAGCT
ACGGCTCTCTCCTCCTTCAATGGCGCCGTGCTACTAATTTCACACGATCGTTTCCTTGTTCGGTCGGTAATTGAG
GGCAAGCGAGATACCGAGCATAAGCTTGATGAAGATTTCGAAGGGCTGGAGGAGGAAGAGACCGAAGAAACGCCA
AGGCGCCGGTCGGTCTATGTGATTAAACAAGGCAAGATGAACGAACAGAAGAATGGGGTGGAGCAGTTCGAAAAG
AGCCTGGTGAAGAGGAACTTCCTCATGGCTGGCTTGTGCAAGCGGATCTTGTCTTGCCCTAGGGTTGCCCGTCAG
TGGGGCATACAGACTCGACTTCAGAGCACTCGCGCCGCATCAAGATCTAACGCCACCGTCGTCCCTGAATTGCCT
CCTCCGCATCCCGCAACCGAGGCCTCCAAACCGTCAAAATTCAAGTCCACGAAGCCCTTCTCCGAATTCCTCACC
GATACCTTCAATCGGCAACATGACTATCTCCGCATTAGCGTCACGGAACGGTGCAATCTCCGGTGTCTGTATTGC
ATGCCCGAGGAAGGCATAGACCTCTCGCCCTCTGCGAAACTGCTTACATCCCCGGAGATCCTATACCTATCCTCG
CTATTCGTCTCACAAGGCGTGACCAAAATCCGATTGACTGGCGGAGAACCGACGGTCCGCAAGGACATCGTGCCA
TTGATGCAGGACATTGGCAAGCTGCGACAAAATGGGCTTCGGGAATTGTGTCTAACAACCAACGGAATCTCATTA
CATCGAAAATTGGACTCGATGGTGGAGGCTGGTTTGACGGGAGTCAATCTCAGCCTTGACACGCTGGATCCATTC
CAGTTCCAGATCATGACGAGACGCAAGGGATTCGATGCTGTGATGAAGAGCATCGACCGCATTCTGGAAATGAAT
AAGGTCGGTGCGGGGATCAAGTTGAAGATCAATTGTGTTGTTATGAGGGGAATGAACGACCGAGAGATCCTTCCG
TTCGTGGAGCTGGGCCGCGAGAAGCCGATTGAAGTGCGCTTCATCGAGTATATGCCTTTCGGTGGAAACAAATGG
AACCAGGAAAAGATGTTCTCATATCAGGAGATGCTGGCTGTTATCCGAGAGAAGTATCCCACGTTCGAAAAAGTG
GCCGACCACAAGAATGACACGAGTAAGACATACCGTGTTCCTGGCTTCGAGGGCCGCGTGGGATTTATCACGAGC
ATGACACACAACTTCTGTGGTACCTGCAACAGGCTACGTATTACTAGCGACGGAAATCTCAAAGTCTGTCTGTTC
GGTAACTCTGAAGTCTCCTTGCGGGATATCATTCGTAAGGAGAATGGTGGGAGCCCGATTGACGTGGATGCAATG
AACAACCTGCAGCTGTTGGAAACAGTACAAAACGCAGCGCGCCTTAGCGACGAAGGCGGCTTGGTGAATGAACGA
GAACGTGAGATTCTCGACATCATCGGCATGGCAGTGAAACGAAAGAAGGCGAAACACGCCGGCATGGCACAACTT
AAGGATATGAAGAACCGTCCTATGATCTTGATTGCTTCCCAAAGTCGTCTCTACCACCCCGGGCGCTCTAAGCCA
GAGACCACAGACTGTACTTCTCGTCCATCTCCCTCTCTACCCACCACCTCAGACACCGACCTCCCTCACCTTACA
CCATCCAAGACCGTACACATGACACAGATCACCGAAAAGCCCGAAACAAAGCGCGTCGCCACAGCCGCCTGCACC
GTCTCCTTCTCAAACGCCCGACCCTGGGAAATCCTCCGCGAAGGCCAAACCACGCACAAAGGCGACGTCTTCAGC
GTCGCCCGGATCGCGGGTATCATGGCCGCCAAAAGAACGCCTGATATTGTGCCCCTTTGCCATCCCGGCATTGGT
ATTACCGGAGTCGAGGTCAGCGTGGAACTCGTTGGGCCTGCGGGGGACAGGGACAGGGATCACGGCGCCATGCAT
GTCGTGGCGTCGGTCAGCTGCTTCGGTCGCACAGGCGTAGAAATGGAGGCTATGACGGCTACTATGGGTGCGGCT
TTGACGGTTTATGATATGCTCAAGGCTGTGGATAAGGGGATGGTCATTGATTCTGTCCGATTGTTGGAGAAACAG
GGTGGGAAGAGTGGGCATTGGGTACGGGAATGA
Gene >Pro_DTO377G3_2|g856.t1
ATGACATCGGCCCCGACAATTCTGGCTACGTGCAAGCAGACACGGTTTCATCTGCTAGATGATAATCCTTCGCAG
GAGGTATGGGTAGCCACAACAATGATCTAGATGCCCATTAACGTTCAAATATGTTCTGTTGACAGATCGATGTGG
AGGGACTTAACATCATAGTCACATCATCTGCACCTGAATCCACGGAAGATGCCTCAAAGCCAAAGACCAAAGGAA
AATCAAGGGCCAAGGCTGCGGGGAGAGAGCTCATATCAGACGCGCACCTACGACTCAAGGCAGGCGTTCACTATG
GGTTACTAGGTCGCAACGGAACTGGAAAGTCAAGTGAGACAGAGCCCCGCAAGTACTGTCTACAAATCTCAGTAT
ACTGATGATACCAGCGCTGCTCCGGGCAATGGCCGAGAAACTCATTCCTGGCATCCCGCATGCGACTCGCATGGC
TATTTTGCAGCAAACAGACCAGCAGGATGACGTTACATTCGGCGAAGACCCTAATCAGGACAAAACTGTTTTGGA
AGCCGTTCTCAGCAGCGATGAAAGTAGGAACGAGGCTGTTCGGATGACAGAATGTCAGTATGCCTATTCAATTGG
GGGTTGTACTTGACTAACTTGACAAGTTCTGTCGAAAAGTTTTGAGACTGAAGATCCAATGCAGCCCGTGCGGGC
GATCCGTAAAATCCGGCACCAGAAAGCAGAAAAGCATCTCTTCCTGGCTCACAAGAACGCAAGCCTGAAAAGCGG
TGCTCGAGGTCTACAAGCAAGAAAAGACCTGAAGGCTGCCGAGGGGAAGCTCGAGGCTGCATCGGAGATGTAAGT
TGCATTAATTCGCGCTAGAGACTATATCTAACTTCTGCCAGGTTGGCCCAGGATGTAGCCGCTATCGATGCGGAG
ACAGTCCAGTCGGATACCCAAGCTGCCGTTGAGACACTACAAAATTTACAGTCTCAAATCGAAGACGTAAGTCTT
CGTAGGATGACCATTCACCTGCTCCGCTAACATGAAACAAGATGAAACTTGCTGATATGAAGCAACAAGCCCGTC
GCGTTCTTCTTGGTCTCGGCTTTAAAGAAGACGGATTCGAGAAGAAAGTCTCTACGCTCTCAGGTGGCTGGCGTA
TGCGATGTATGCTAGCCAGCGTTCTGGTCCAAGACCCCGACATCATGATCCTAGATGAGCCGACCAACTTCCTCG
ATCTGCTAGGAGTAGTGTGGCTAGAGAATTACCTGAAACAACTCCGCGACACATCAGAAACAACCATCGTCTTGG
TTTCACACGACAGAGATTTCATCAATGCTGTCTGCGAGGAGATTGTCATTCTGCGAGATCAGAAATTGACTTATT
TCCGAGGGAACCTGTCTGCATACGAGCAAGATTTCGAGGAACAGAAGCTCTACCTAGGGCGCATGAAGGAGGCCC
AAGAACGGCAGGTTGCGCATATGGAAGCTAGTATCCGGGAGAATATGAAAATTGGAAAGAAGACCAATGACGAAA
ATAAGCTGCGACAAGCTAAGTCACGGCAGAAAAAGGTCGATGACCGGATGGGTCTTCAAGTCAGCGCAAACGGGG
GACGTTTCAAGCTGAACCGTGATCTAGTCGGATGGCATCTCCACAATCGGGCTGAGATCGACGTTCCGACAGATG
AAAAGGGCGCGACTATGAGCTTGCCCGATGCGACGGAGTTGCGGTTCCCTGGGCCGCTGGTATCGCTTGAGGGTA
TTGTCTTCCAGTACAAGAAAACCGACCGCGTCATCCTGGATGACGTGAACTTGGTTGTTCACCTGGGTGATCGTG
TCGGAATTATGGGTCTCAATGGATCGGGGAAAACAACGCTGCTCCGTATTTTGACGGGACAGGTGTCTCCTTCCA
AGGGCAAGGTGTCGACTCACTCCCGGTTGAAAGTGGGCTACTATAGCCAACACTCCGTGGAAGAGCTGCAAGAAC
GTGGCCGAGGCGAGCCTAGCTTAACTGCGCTGGGCTTGTTGACAATTGAGACTGAAGGATCGCTGAACGAGGGCG
CTATCAGAGGTCTACTTTCTTCAATGGGGTTAGCGGGTCGTATTGCATCTGATGTCCCTGTGGCCAAGCTGTCAG
GCGGACAACTGGTATGTGAAACAATGTGGAACATTAAAGCAAGCTACTAATAATATCGTCAATTTAGGTCCGCCT
TGCATTAGCTCGAATCGTCTGGAGTGCACCACAACTTCTGATTCTTGATGAAATCACCACGCATTTGGATTTCCA
CACTGTCACTGCATTAGCTACGGCTCTCTCCTCCTTCAATGGCGCCGTGCTACTAATTTCACACGATCGTTTCCT
TGTTCGGTCGGTAATTGAGGGCAAGCGAGATACCGAGCATAAGCTTGATGAAGATTTCGAAGGGCTGGAGGAGGA
AGAGACCGAAGAAACGCCAAGGCGCCGGTCGGTCTATGTGATTAAACAAGGCAAGATGAACGAACAGAAGAATGG
GGTGGAGCAGTTCGAAAAGAGCCTGGTGAAGAGGGTACAGAAGTTGTTAGCGACTATAGATTAGTTAGTTAACTA
ACTAAATGGCTGATGTCGTGCCTCCATGACCAATTATTCTTCCGCGGGTGAAGATATGATATCATGACTCAGCAC
GGAGCCCGCCGAGAGGCATGTGCGATAAGAGACATTCCCCTCATTCCTCCGCGGAGTATCTCATTGCATATATAT
TTGCAACATGCACCATTTTACCCCTTGAAAGAACTTCCTCATGGCTGGCTTGTGCAAGCGGATCTTGTCTTGCCC
TAGGGTTGCCCGTCAGTGGGGCATACAGACTCGACTTCAGAGCACTCGCGCCGCATCAAGATCTAACGCCACCGT
CGTCCCTGAATTGCCTCCTCCGCATCCCGCAACCGAGGCCTCCAAACCGTCAAAATTCAAGTCCACGAAGCCCTT
CTCCGAATTCCTCACCGATACCTTCAATCGGCAACATGACTATCTCCGCATTAGCGTCACGGAACGGTGCAATCT
CCGGTGTCTGTATTGCATGCCCGAGGAAGGCATAGACCTCTCGCCCTCTGCGAAACTGCTTACATCCCCGGAGAT
CCTATACCTATCCTCGCTATTCGTCTCACAAGGCGTGACCAAAATCCGATTGACTGGCGGAGAACCGACGGTCCG
CAAGGACATCGTGCCATTGATGCAGGACATTGGCAAGCTGCGACAAAATGGGCTTCGGGAATTGTGTCTAACAAC
CAACGGAATCTCATTACATCGAAAATTGGACTCGATGGTGGAGGCTGGTTTGACGGGAGTCAATCTCAGCCTTGA
CACGCTGGATCCATTCCAGTTCCAGATCATGACGAGACGCAAGGGATTCGATGCTGTGATGAAGAGCATCGACCG
CATTCTGGAAATGAATAAGGTCGGTGCGGGGATCAAGTTGAAGATCAATTGTGTTGTTATGAGGGGAATGAACGA
CCGAGAGATCCTTCCGTTCGTGGAGCTGGGCCGCGAGAAGCCGATTGAAGTGCGCTTCATCGAGTATATGCCTTT
CGGTGGAAACAAATGGAACCAGGAAAAGATGTTCTCATATCAGGAGATGCTGGCTGTTATCCGAGAGAAGTATCC
CACGTTCGAAAAAGTGGCCGACCACAAGAATGACACGAGTAAGACATACCGTGTTCCTGGCTTCGAGGGCCGCGT
GGGATTTATCACGAGCATGACACACAACTTCTGTGGTACCTGCAACAGGCTACGTATTACTAGCGACGGAAATCT
CAAAGTCTGTCTGTTCGGTAACTCTGAAGTCTCCTTGCGGGATATCATTCGTAAGGAGAATGGTGGGAGCCCGAT
TGACGTGGATGCAATGAACAACCTGCAGCTGTTGGAAACAGTACAAAACGCAGCGCGCCTTAGCGACGAAGGCGG
CTTGGTGAATGAACGAGAACGTGAGATTCTCGACATCATCGGCATGGCAGTGAAACGAAAGAAGGCGAAACACGC
CGGCATGGCACAACTTAAGGATATGAAGAACCGTCCTATGATCTTGATTGGTGGGTAGCCTTTTGTTTTTTTTTT
CTTGATGATTGGAAACGCTTTACGACTTGTAGATCATCCATATGAACATTTCTTTTGGATCTCATGGCATTGGCG
ATATTTTGATACCATGTATACATGCAATTGATGTGTTTAGACATTGTTTGAATCATTAAGCTGATAGATGAACTA
GATAATAAACCGCCATGGAGGTCAGGGTCTCCCTCTTGGTCTTCCATACCAGTACATATACTTTCGCATCTCCCT
ACAGCTTCCCAAAGTCGTCTCTACCACCCCGGGCGCTCTAAGCCAGAGACCACAGACTGTACTTCTCGTCCATCT
CCCTCTCTACCCACCACCTCAGACACCGACCTCCCTCACCTTACACCATCCAAGACCGTACACATGACACAGATC
ACCGAAAAGCCCGAAACAAAGCGCGTCGCCACAGCCGCCTGCACCGTCTCCTTCTCAAACGCCCGACCCTGGGAA
ATCCTCCGCGAAGGCCAAACCACGCACAAAGGCGACGTCTTCAGCGTCGCCCGGATCGCGGGTATCATGGCCGCC
AAAAGAACGCCTGATATTGTGCCCCTTTGCCATCCCGGCATTGGTATTACCGGAGTCGAGGTCAGCGTGGAACTC
GTTGGGCCTGCGGGGGACAGGGACAGGGATCACGGCGCCATGCATGTCGTGGCGTCGGTCAGCTGCTTCGGTCGC
ACAGGCGTAGAAATGGAGGCTATGACGGCTACTATGGGTGCGGCTTTGACGGTTTATGATATGCTCAAGGCTGTG
GATAAGGGGATGGTCATTGATTCTGTCCGATTGTTGGAGAAACAGGGTGGGAAGAGTGGGCATTGGGTACGGGAA
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail