Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8555.t1
Gene name
Locationscaffold_34:140291..141221
Strand+
Gene length (bp)930
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.0E-07 8 73
PF14605 Nup35_RRM_2 Nup53/35/40-type RNA recognition motif 6.3E-07 5 62

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8555.t1
MANSTVHVSGISSTTSEKEVRDFFSFCGKIVTLSITPVSGEADAPKSATVTFEKEAAAKTALLLDQTQLGTSAVH
VEATHNIEEIGGSHVTDAETEAREEEHIAQEDKPRSRIVAEYLAHGYVVSDNAIMKAIALDKKHGVSHRFTTALT
NFDKKYNATERAKGIDNDYQISTKAANGWRGLSSYFEKALESPSGQKLRDFYVQTDKQVRDIHAEARRLADLKQG
KTEAAAAAPGPAAVAEPATEPAAQPAAVPSQPEAAAAPVEKS*
Coding >Pro_DTO377G3_2|g8555.t1
ATGGCTAATTCCACTGTCCACGTTTCTGGCATCTCGTCAACAACCTCCGAGAAGGAGGTTCGCGACTTCTTCAGC
TTCTGCGGAAAGATTGTCACCCTCTCCATCACCCCAGTCTCTGGGGAGGCCGATGCTCCGAAGTCCGCCACTGTG
ACGTTCGAAAAGGAGGCCGCAGCCAAGACTGCCCTCCTCCTAGACCAGACCCAACTGGGCACTTCTGCCGTTCAC
GTTGAAGCAACCCACAACATCGAAGAAATAGGCGGATCCCATGTCACCGACGCGGAGACCGAGGCCCGGGAAGAG
GAGCACATCGCGCAAGAAGACAAGCCCCGATCGCGCATCGTCGCAGAGTACCTGGCGCACGGGTACGTAGTGAGC
GACAATGCCATCATGAAGGCGATCGCGCTGGACAAGAAGCACGGTGTCTCGCACCGCTTCACGACCGCGCTCACC
AACTTCGATAAGAAGTACAATGCCACCGAGCGCGCCAAGGGCATCGATAACGACTATCAGATCTCCACTAAGGCA
GCCAATGGCTGGCGCGGCCTGAGCTCGTACTTCGAGAAGGCCCTGGAGTCCCCCTCTGGCCAGAAGCTGCGCGAC
TTTTATGTTCAGACCGATAAGCAGGTGCGCGATATCCACGCCGAGGCCCGTCGTCTGGCGGATTTGAAGCAGGGT
AAGACTGAGGCTGCTGCCGCTGCCCCTGGCCCTGCTGCTGTTGCTGAGCCTGCTACTGAGCCCGCTGCTCAGCCC
GCTGCTGTTCCTTCTCAGCCCGAGGCTGCTGCTGCGCCTGTTGAGAAGTCCTAA
Transcript >Pro_DTO377G3_2|g8555.t1
ATGGCTAATTCCACTGTCCACGTTTCTGGCATCTCGTCAACAACCTCCGAGAAGGAGGTTCGCGACTTCTTCAGC
TTCTGCGGAAAGATTGTCACCCTCTCCATCACCCCAGTCTCTGGGGAGGCCGATGCTCCGAAGTCCGCCACTGTG
ACGTTCGAAAAGGAGGCCGCAGCCAAGACTGCCCTCCTCCTAGACCAGACCCAACTGGGCACTTCTGCCGTTCAC
GTTGAAGCAACCCACAACATCGAAGAAATAGGCGGATCCCATGTCACCGACGCGGAGACCGAGGCCCGGGAAGAG
GAGCACATCGCGCAAGAAGACAAGCCCCGATCGCGCATCGTCGCAGAGTACCTGGCGCACGGGTACGTAGTGAGC
GACAATGCCATCATGAAGGCGATCGCGCTGGACAAGAAGCACGGTGTCTCGCACCGCTTCACGACCGCGCTCACC
AACTTCGATAAGAAGTACAATGCCACCGAGCGCGCCAAGGGCATCGATAACGACTATCAGATCTCCACTAAGGCA
GCCAATGGCTGGCGCGGCCTGAGCTCGTACTTCGAGAAGGCCCTGGAGTCCCCCTCTGGCCAGAAGCTGCGCGAC
TTTTATGTTCAGACCGATAAGCAGGTGCGCGATATCCACGCCGAGGCCCGTCGTCTGGCGGATTTGAAGCAGGGT
AAGACTGAGGCTGCTGCCGCTGCCCCTGGCCCTGCTGCTGTTGCTGAGCCTGCTACTGAGCCCGCTGCTCAGCCC
GCTGCTGTTCCTTCTCAGCCCGAGGCTGCTGCTGCGCCTGTTGAGAAGTCCTAA
Gene >Pro_DTO377G3_2|g8555.t1
ATGGCTAATTCCACTGTCCACGTTTCTGGCATCTCGTCAACAACCTCCGAGAAGGAGGTTCGCGACTTCTTCAGC
TTCTGGTACATTATTACAATGATTTTTTTTATTTGACCAAGTGCTAACATAAAACAGCGGAAAGATTGTCACCCT
CTCCATCACCCCAGTCTCTGGGGAGGCCGATGCTCCGAAGTCCGCCACTGTGACGTTCGAAAAGGAGGCGTAAGC
TACCCCGCACCCAGTTTCAGCCCGCAATCAGCCCACATCAACACAAACTAACGCAATTTCTAAAACAGCGCAGCC
AAGACTGCCCTCCTCCTAGACCAGACCCAACTGGGCACTTCTGCCGTTCACGTTGAAGCAACCCACAACATCGAA
GAAATAGGCGGATCCCATGTCACCGACGCGGAGACCGAGGCCCGGGAAGAGGAGCACATCGCGCAAGAAGACAAG
CCCCGATCGCGCATCGTCGCAGAGTACCTGGCGCACGGGTACGTAGTGAGCGACAATGCCATCATGAAGGCGATC
GCGCTGGACAAGAAGCACGGTGTCTCGCACCGCTTCACGACCGCGCTCACCAACTTCGATAAGAAGTACAATGCC
ACCGAGCGCGCCAAGGGCATCGATAACGACTATCAGATCTCCACTAAGGCAGCCAATGGCTGGCGCGGCCTGAGC
TCGTACTTCGAGAAGGCCCTGGAGTCCCCCTCTGGCCAGAAGCTGCGCGACTTTTATGTTCAGACCGATAAGCAG
GTGCGCGATATCCACGCCGAGGCCCGTCGTCTGGCGGATTTGAAGCAGGGTAAGACTGAGGCTGCTGCCGCTGCC
CCTGGCCCTGCTGCTGTTGCTGAGCCTGCTACTGAGCCCGCTGCTCAGCCCGCTGCTGTTCCTTCTCAGCCCGAG
GCTGCTGCTGCGCCTGTTGAGAAGTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail