Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g855.t1
Gene name
Locationscaffold_01:2275257..2281315
Strand-
Gene length (bp)6058
Transcript length (bp)5037
Coding sequence length (bp)5037
Protein length (aa) 1679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13691 Lactamase_B_4 tRNase Z endonuclease 4.2E-25 640 702
PF00170 bZIP_1 bZIP transcription factor 1.9E-06 299 353

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008033 tRNA processing Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0071704 organic substance metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0140110 transcription regulator activity No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0034470 ncRNA processing No
GO:0043170 macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:0006399 tRNA metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0065007 biological regulation No
GO:0046483 heterocycle metabolic process No
GO:0050789 regulation of biological process No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0044237 cellular metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0019222 regulation of metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0008152 metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006396 RNA processing No
GO:0009889 regulation of biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g855.t1
MATLADHPMQPVANYDQDLDSFINFDQLTYTSDPSRSKVMVSQPSVASTEFSASDARSASFASSGQSPLAYQAPS
HQYDEHRQQTGLPPGALSMSYSQVPMGFNNGQVFPVNAEVYAGHHMKREDAQFDFNTAPGRNPSEMEIDPETMNP
SPYFYPANPGTKSQYVDPNALGGHELAQAGPSTQVGRMYPGMHQQQAAMAKAQQQKQIEMVRPQIQQRPDQVGHA
ISQVRGPRNPDPVVEERISRLLQQMRQNAMANGEGSPSPSNGMPQMAKARKDEADMDEDERLLASEEGKKLSSKE
RRQLRNKVSARAFRSRRKEYIGQLESEVAARTNEAHEIRLQNRALYEENARLNDLARMLLGSPHFSNFLNDMGDT
LPAQPQQQSQQPQQQQQVQQAAPNMQAMPKDSNANRGQEFQMQQNPQPNMVMVSNQGMDHSSMGMNNAGWNSGID
MNYGNTPVFAVMEVPEGPALDVEALSGKSSSSFSLPESSKNEAPVVERSASDSFSQSDIGVVNPDVEIDESDPAF
ALFVDSPAPAADLTFEGVSTEKNAQFQLVIDSSEVSDSAKRTFNALCNSIDAAFERVSAVTQPAIKENAYFLQAP
ALNRRRPDNDDYLICEPSKLELVPLPIPVEGIAPMKFFYQVITTPTADTPGTAVCLNFPDKRYFFGQVSEGTQRA
CTERGIKLSLLTDVFVTGRTEWANTGGLIGIVLTLADTVASSMAAIEDEQRKKAARRAEREAEENTKSKPRAPQN
GRTPAPALVERDGETVSQRGNLTIHGAANLTHTLATSRRFVFRKGMPVYLKEYDSETLAKQMPIGAEDPFEKPSW
SDSNIKVWALPIKPHPSARSPVTQPLSQSPRKRSLDEFQESEQTGDHMDQRTKNLMVTQSIVQDMFNSTWKMDAL
HETPLAEVKMPAAIFIRNPETKDLEQYKGPVPGGSDELPDIKVLVRKPWPGATIESLPTTSPSKEAVCYIVRNHD
IRGKFDPKKARELNVEKGSKYAALTKGESVQSLDGKTITPDMVLGQTRAGKGVAIMELPSSDYVEDLVNRPEWKS
PAVTTELQAFIWILGPGVAENPKFQEFVASMSHCKHTVSSTDHCPNYLALTCSASSTVRLARLKSDSYAVPVHDN
VTLPQPGSPNANSQSAIAARQNSPLQPLVPGFIINMEPNFGFNSEDVMTRFNPANVLNSIPRSVTQRMEVISSRV
AKPAFQKKLHEQRTQWPGADAEIIALGTGSSVPSKYRNVSATLLKVPGYGYYLLDCGENTLGQLKRVFEPEELRE
VLQNLRMIWISHLHADHHLGTVSVIKAWHAENFKDGFGSAARRENDIAKILQEKRLALVSDDAMISWLEEYSQVE
NFGFDKLLTLSAHPEVQGSKITTEFSHQLPNRHRLHVDFTDESSPITPLLKSATGLADILTCRVKHCKGALAVSL
VFSNGFKVSYSGDCRPSDKFAAIGQGSTVLIHEATFQPDMVGSARAKRHSTSSEAIEIGRRMQARAVLLTHFSQR
YQKIAFVEKQNPGKFPNNRDAAAKEPADADIPFDDPQDESAGNDAPMSDDINMTTSSQRLGVYTGPVAGAMDFMR
IKVGDFALAQAYAPALEKLVELLERAANEESERVKLMRQEEENARKAKNNKKLAKQMATATAAAAAAALTETSDV
PAVPTRSVWSASESEEGWETSDHEECCS*
Coding >Pro_DTO377G3_2|g855.t1
ATGGCGACTCTCGCAGACCATCCTATGCAACCAGTGGCCAACTACGACCAGGATCTCGACTCATTCATCAACTTT
GATCAACTCACCTACACATCTGATCCCTCTCGCTCCAAGGTTATGGTCAGCCAACCATCGGTCGCAAGTACAGAG
TTCAGCGCCAGTGACGCCCGCAGTGCCAGCTTTGCCTCAAGTGGCCAGTCTCCTCTAGCATACCAGGCCCCAAGC
CACCAATACGACGAACACAGACAACAGACTGGTCTCCCACCAGGTGCTTTGTCCATGTCTTACAGCCAGGTCCCG
ATGGGTTTCAACAACGGTCAAGTATTTCCCGTGAACGCTGAAGTGTATGCTGGTCATCACATGAAGCGCGAGGAC
GCACAATTTGACTTCAACACCGCACCGGGCCGGAACCCATCGGAGATGGAGATTGATCCCGAAACCATGAATCCT
TCGCCATACTTCTACCCCGCAAACCCTGGCACCAAGAGCCAATATGTCGATCCCAACGCTCTCGGAGGCCATGAG
CTGGCTCAGGCTGGTCCGTCCACACAAGTCGGTCGCATGTACCCTGGCATGCATCAGCAGCAGGCTGCGATGGCC
AAGGCACAGCAACAAAAGCAAATTGAGATGGTCCGTCCTCAGATACAGCAGCGTCCGGATCAAGTGGGCCATGCT
ATTTCTCAGGTCCGCGGTCCCCGTAACCCCGACCCCGTCGTCGAGGAGCGTATCTCTCGTCTACTTCAACAGATG
CGACAGAATGCCATGGCCAATGGCGAGGGCTCCCCCAGCCCTTCCAATGGTATGCCGCAGATGGCCAAGGCCCGG
AAGGATGAGGCCGATATGGATGAAGACGAGCGTCTTCTCGCTAGCGAAGAGGGCAAAAAGCTCAGCAGCAAGGAG
CGCCGCCAGTTGCGGAACAAGGTTTCCGCTCGCGCTTTCCGATCTCGCCGCAAGGAATACATTGGTCAGCTCGAA
AGTGAGGTGGCCGCTAGAACCAACGAGGCGCACGAAATTCGCCTCCAGAACCGCGCTCTTTACGAAGAAAATGCC
CGCCTGAACGACTTGGCCCGCATGCTCCTGGGATCTCCCCATTTCTCCAACTTCCTGAACGACATGGGTGACACC
CTGCCCGCTCAACCTCAACAGCAATCTCAACAACCCCAGCAACAGCAACAAGTTCAGCAGGCTGCACCCAACATG
CAGGCTATGCCTAAGGACTCGAACGCCAACCGTGGTCAAGAGTTCCAGATGCAGCAGAACCCCCAGCCCAACATG
GTCATGGTTTCAAACCAGGGTATGGACCACTCCAGCATGGGCATGAACAACGCCGGCTGGAACTCAGGAATCGAC
ATGAACTACGGTAACACTCCCGTATTTGCTGTCATGGAGGTTCCCGAGGGCCCGGCCCTCGATGTCGAAGCTCTG
TCCGGAAAATCCTCTTCTTCCTTCAGCCTCCCCGAGAGCTCTAAGAATGAAGCTCCTGTTGTCGAGCGTTCTGCT
AGCGACTCATTCAGCCAGTCTGACATTGGTGTTGTCAACCCTGATGTTGAGATTGATGAGTCCGATCCTGCCTTT
GCTCTCTTTGTTGATTCTCCTGCGCCCGCTGCCGACCTCACATTCGAGGGTGTTTCGACCGAGAAGAATGCTCAG
TTCCAACTCGTCATTGACAGCTCTGAAGTCAGCGATTCGGCCAAGAGAACCTTCAACGCCCTTTGCAACAGCATT
GACGCTGCCTTCGAGCGTGTCTCAGCTGTTACACAACCTGCAATCAAAGAGAACGCATACTTTCTTCAAGCCCCG
GCCTTGAACAGACGACGGCCCGATAACGACGACTACTTGATTTGTGAACCATCCAAACTCGAACTCGTTCCATTG
CCTATACCGGTAGAAGGAATTGCCCCGATGAAATTCTTCTACCAGGTCATCACGACCCCAACGGCCGATACCCCC
GGCACGGCCGTTTGCCTCAACTTCCCAGACAAGCGATACTTCTTCGGCCAGGTATCAGAAGGCACACAGCGTGCA
TGCACAGAGCGCGGGATCAAGCTATCTCTTCTCACCGATGTCTTTGTCACTGGACGGACGGAATGGGCCAACACA
GGCGGTTTGATTGGGATTGTTCTGACCCTTGCTGATACGGTGGCATCTTCCATGGCGGCTATTGAGGACGAACAA
AGAAAGAAGGCTGCCCGCAGGGCGGAACGGGAGGCCGAAGAAAATACAAAATCTAAGCCCCGTGCACCCCAAAAT
GGTAGGACCCCTGCCCCTGCCCTTGTGGAGCGGGACGGCGAGACGGTCTCGCAGCGAGGTAACCTCACCATTCAT
GGTGCTGCAAATCTTACACATACACTGGCTACGTCTCGACGGTTTGTTTTCCGAAAGGGCATGCCGGTGTATTTG
AAAGAATATGACTCGGAAACCCTCGCTAAGCAAATGCCTATCGGCGCCGAGGATCCCTTTGAGAAGCCATCATGG
TCCGACAGTAACATCAAAGTCTGGGCTCTGCCTATTAAACCTCACCCATCGGCGCGTTCTCCAGTTACGCAGCCG
TTGTCACAGAGTCCACGAAAGCGGAGCTTGGACGAGTTCCAGGAATCTGAACAGACCGGAGATCATATGGACCAA
CGTACTAAGAACTTGATGGTGACGCAGTCTATTGTGCAGGATATGTTTAACTCAACGTGGAAGATGGATGCCCTC
CATGAAACCCCATTGGCTGAGGTCAAGATGCCGGCCGCCATATTCATTCGCAACCCAGAAACCAAGGACCTTGAA
CAATACAAAGGTCCGGTGCCGGGTGGCTCAGATGAGCTGCCAGACATCAAGGTGCTCGTTCGAAAGCCCTGGCCC
GGTGCTACTATCGAGAGTCTCCCAACCACTTCTCCCTCGAAAGAGGCTGTCTGCTATATCGTGCGAAACCACGAT
ATCCGCGGAAAGTTCGACCCGAAGAAGGCCCGAGAATTGAACGTTGAGAAGGGTTCTAAGTACGCGGCTTTGACG
AAGGGCGAGAGCGTTCAATCCCTAGATGGCAAGACTATCACTCCAGATATGGTCTTGGGACAGACGCGAGCAGGA
AAAGGCGTTGCCATCATGGAATTGCCATCGTCTGATTACGTCGAGGACCTGGTAAACCGGCCCGAATGGAAGTCA
CCAGCCGTGACGACCGAGTTGCAGGCCTTCATCTGGATTCTTGGACCAGGCGTGGCTGAGAATCCTAAATTCCAG
GAATTCGTTGCCAGCATGTCCCACTGCAAGCACACCGTGTCGAGCACAGACCACTGCCCGAACTACCTGGCATTG
ACCTGCTCTGCTAGCTCGACTGTTCGCCTCGCCCGTCTGAAAAGCGATAGCTATGCGGTTCCTGTTCACGACAAT
GTGACCCTTCCCCAACCGGGCTCACCTAATGCCAATTCACAATCTGCAATTGCTGCTCGCCAGAATTCTCCACTG
CAGCCTCTTGTACCCGGATTCATCATCAACATGGAGCCCAATTTCGGGTTCAACAGTGAGGATGTGATGACCCGC
TTCAACCCAGCGAATGTATTGAATAGCATCCCGCGTTCTGTTACACAAAGAATGGAAGTCATTAGCAGCCGCGTG
GCTAAACCTGCTTTCCAGAAAAAGTTGCACGAGCAACGGACACAATGGCCTGGAGCGGATGCAGAAATCATCGCC
CTGGGTACTGGTTCTTCTGTTCCATCTAAATACCGAAATGTCTCTGCCACACTGCTAAAGGTGCCTGGATATGGC
TACTATCTGCTTGACTGTGGTGAGAATACTCTTGGTCAACTGAAGCGAGTTTTCGAGCCCGAAGAACTTCGTGAA
GTGCTTCAGAACCTGCGAATGATTTGGATCAGCCACTTGCACGCTGATCACCACCTAGGAACGGTCTCTGTGATC
AAGGCCTGGCACGCAGAGAACTTCAAGGATGGATTTGGCTCGGCTGCTAGACGTGAAAACGACATAGCCAAGATC
CTCCAGGAGAAACGGCTGGCACTTGTGTCTGATGATGCAATGATATCCTGGTTGGAAGAATACTCACAGGTCGAG
AACTTCGGGTTCGACAAGTTGCTTACTCTTTCCGCGCATCCCGAAGTACAAGGTTCTAAAATCACCACCGAGTTC
TCACACCAACTACCTAATCGTCATCGTCTTCATGTTGATTTCACGGACGAATCCTCCCCCATCACTCCTCTTCTC
AAGTCTGCCACCGGCCTTGCAGACATACTCACTTGCCGTGTCAAACACTGCAAGGGTGCGCTCGCCGTCTCCCTT
GTCTTCTCAAATGGATTCAAGGTTTCCTACTCCGGTGACTGCAGGCCATCAGATAAATTTGCCGCCATTGGACAG
GGTTCGACCGTGCTTATCCATGAGGCCACCTTCCAACCCGACATGGTCGGATCGGCTAGGGCCAAACGGCACTCG
ACCTCCTCCGAGGCAATCGAAATTGGCCGCCGCATGCAAGCGCGCGCTGTCCTGCTCACTCATTTCAGCCAACGC
TACCAGAAGATAGCGTTTGTAGAGAAGCAAAATCCAGGCAAATTCCCGAATAACCGGGATGCAGCTGCAAAGGAG
CCCGCAGATGCGGATATCCCATTCGACGACCCCCAGGATGAATCAGCGGGCAACGACGCCCCAATGTCCGACGAC
ATCAACATGACGACATCAAGCCAAAGGCTCGGCGTCTATACCGGCCCCGTCGCGGGAGCGATGGACTTCATGCGT
ATCAAGGTCGGGGACTTCGCCCTTGCGCAAGCATATGCGCCAGCGTTGGAGAAGCTGGTCGAGCTCTTGGAGCGA
GCGGCGAACGAGGAATCCGAGCGCGTGAAACTGATGCGCCAGGAAGAGGAGAATGCCCGCAAGGCGAAGAATAAT
AAGAAGTTGGCTAAGCAAATGGCTACTGCTACGGCTGCGGCAGCTGCGGCTGCATTGACTGAGACTAGCGATGTC
CCGGCGGTGCCCACTCGATCTGTCTGGAGTGCCAGTGAAAGCGAGGAGGGGTGGGAGACGAGTGACCACGAGGAA
TGTTGTTCCTAA
Transcript >Pro_DTO377G3_2|g855.t1
ATGGCGACTCTCGCAGACCATCCTATGCAACCAGTGGCCAACTACGACCAGGATCTCGACTCATTCATCAACTTT
GATCAACTCACCTACACATCTGATCCCTCTCGCTCCAAGGTTATGGTCAGCCAACCATCGGTCGCAAGTACAGAG
TTCAGCGCCAGTGACGCCCGCAGTGCCAGCTTTGCCTCAAGTGGCCAGTCTCCTCTAGCATACCAGGCCCCAAGC
CACCAATACGACGAACACAGACAACAGACTGGTCTCCCACCAGGTGCTTTGTCCATGTCTTACAGCCAGGTCCCG
ATGGGTTTCAACAACGGTCAAGTATTTCCCGTGAACGCTGAAGTGTATGCTGGTCATCACATGAAGCGCGAGGAC
GCACAATTTGACTTCAACACCGCACCGGGCCGGAACCCATCGGAGATGGAGATTGATCCCGAAACCATGAATCCT
TCGCCATACTTCTACCCCGCAAACCCTGGCACCAAGAGCCAATATGTCGATCCCAACGCTCTCGGAGGCCATGAG
CTGGCTCAGGCTGGTCCGTCCACACAAGTCGGTCGCATGTACCCTGGCATGCATCAGCAGCAGGCTGCGATGGCC
AAGGCACAGCAACAAAAGCAAATTGAGATGGTCCGTCCTCAGATACAGCAGCGTCCGGATCAAGTGGGCCATGCT
ATTTCTCAGGTCCGCGGTCCCCGTAACCCCGACCCCGTCGTCGAGGAGCGTATCTCTCGTCTACTTCAACAGATG
CGACAGAATGCCATGGCCAATGGCGAGGGCTCCCCCAGCCCTTCCAATGGTATGCCGCAGATGGCCAAGGCCCGG
AAGGATGAGGCCGATATGGATGAAGACGAGCGTCTTCTCGCTAGCGAAGAGGGCAAAAAGCTCAGCAGCAAGGAG
CGCCGCCAGTTGCGGAACAAGGTTTCCGCTCGCGCTTTCCGATCTCGCCGCAAGGAATACATTGGTCAGCTCGAA
AGTGAGGTGGCCGCTAGAACCAACGAGGCGCACGAAATTCGCCTCCAGAACCGCGCTCTTTACGAAGAAAATGCC
CGCCTGAACGACTTGGCCCGCATGCTCCTGGGATCTCCCCATTTCTCCAACTTCCTGAACGACATGGGTGACACC
CTGCCCGCTCAACCTCAACAGCAATCTCAACAACCCCAGCAACAGCAACAAGTTCAGCAGGCTGCACCCAACATG
CAGGCTATGCCTAAGGACTCGAACGCCAACCGTGGTCAAGAGTTCCAGATGCAGCAGAACCCCCAGCCCAACATG
GTCATGGTTTCAAACCAGGGTATGGACCACTCCAGCATGGGCATGAACAACGCCGGCTGGAACTCAGGAATCGAC
ATGAACTACGGTAACACTCCCGTATTTGCTGTCATGGAGGTTCCCGAGGGCCCGGCCCTCGATGTCGAAGCTCTG
TCCGGAAAATCCTCTTCTTCCTTCAGCCTCCCCGAGAGCTCTAAGAATGAAGCTCCTGTTGTCGAGCGTTCTGCT
AGCGACTCATTCAGCCAGTCTGACATTGGTGTTGTCAACCCTGATGTTGAGATTGATGAGTCCGATCCTGCCTTT
GCTCTCTTTGTTGATTCTCCTGCGCCCGCTGCCGACCTCACATTCGAGGGTGTTTCGACCGAGAAGAATGCTCAG
TTCCAACTCGTCATTGACAGCTCTGAAGTCAGCGATTCGGCCAAGAGAACCTTCAACGCCCTTTGCAACAGCATT
GACGCTGCCTTCGAGCGTGTCTCAGCTGTTACACAACCTGCAATCAAAGAGAACGCATACTTTCTTCAAGCCCCG
GCCTTGAACAGACGACGGCCCGATAACGACGACTACTTGATTTGTGAACCATCCAAACTCGAACTCGTTCCATTG
CCTATACCGGTAGAAGGAATTGCCCCGATGAAATTCTTCTACCAGGTCATCACGACCCCAACGGCCGATACCCCC
GGCACGGCCGTTTGCCTCAACTTCCCAGACAAGCGATACTTCTTCGGCCAGGTATCAGAAGGCACACAGCGTGCA
TGCACAGAGCGCGGGATCAAGCTATCTCTTCTCACCGATGTCTTTGTCACTGGACGGACGGAATGGGCCAACACA
GGCGGTTTGATTGGGATTGTTCTGACCCTTGCTGATACGGTGGCATCTTCCATGGCGGCTATTGAGGACGAACAA
AGAAAGAAGGCTGCCCGCAGGGCGGAACGGGAGGCCGAAGAAAATACAAAATCTAAGCCCCGTGCACCCCAAAAT
GGTAGGACCCCTGCCCCTGCCCTTGTGGAGCGGGACGGCGAGACGGTCTCGCAGCGAGGTAACCTCACCATTCAT
GGTGCTGCAAATCTTACACATACACTGGCTACGTCTCGACGGTTTGTTTTCCGAAAGGGCATGCCGGTGTATTTG
AAAGAATATGACTCGGAAACCCTCGCTAAGCAAATGCCTATCGGCGCCGAGGATCCCTTTGAGAAGCCATCATGG
TCCGACAGTAACATCAAAGTCTGGGCTCTGCCTATTAAACCTCACCCATCGGCGCGTTCTCCAGTTACGCAGCCG
TTGTCACAGAGTCCACGAAAGCGGAGCTTGGACGAGTTCCAGGAATCTGAACAGACCGGAGATCATATGGACCAA
CGTACTAAGAACTTGATGGTGACGCAGTCTATTGTGCAGGATATGTTTAACTCAACGTGGAAGATGGATGCCCTC
CATGAAACCCCATTGGCTGAGGTCAAGATGCCGGCCGCCATATTCATTCGCAACCCAGAAACCAAGGACCTTGAA
CAATACAAAGGTCCGGTGCCGGGTGGCTCAGATGAGCTGCCAGACATCAAGGTGCTCGTTCGAAAGCCCTGGCCC
GGTGCTACTATCGAGAGTCTCCCAACCACTTCTCCCTCGAAAGAGGCTGTCTGCTATATCGTGCGAAACCACGAT
ATCCGCGGAAAGTTCGACCCGAAGAAGGCCCGAGAATTGAACGTTGAGAAGGGTTCTAAGTACGCGGCTTTGACG
AAGGGCGAGAGCGTTCAATCCCTAGATGGCAAGACTATCACTCCAGATATGGTCTTGGGACAGACGCGAGCAGGA
AAAGGCGTTGCCATCATGGAATTGCCATCGTCTGATTACGTCGAGGACCTGGTAAACCGGCCCGAATGGAAGTCA
CCAGCCGTGACGACCGAGTTGCAGGCCTTCATCTGGATTCTTGGACCAGGCGTGGCTGAGAATCCTAAATTCCAG
GAATTCGTTGCCAGCATGTCCCACTGCAAGCACACCGTGTCGAGCACAGACCACTGCCCGAACTACCTGGCATTG
ACCTGCTCTGCTAGCTCGACTGTTCGCCTCGCCCGTCTGAAAAGCGATAGCTATGCGGTTCCTGTTCACGACAAT
GTGACCCTTCCCCAACCGGGCTCACCTAATGCCAATTCACAATCTGCAATTGCTGCTCGCCAGAATTCTCCACTG
CAGCCTCTTGTACCCGGATTCATCATCAACATGGAGCCCAATTTCGGGTTCAACAGTGAGGATGTGATGACCCGC
TTCAACCCAGCGAATGTATTGAATAGCATCCCGCGTTCTGTTACACAAAGAATGGAAGTCATTAGCAGCCGCGTG
GCTAAACCTGCTTTCCAGAAAAAGTTGCACGAGCAACGGACACAATGGCCTGGAGCGGATGCAGAAATCATCGCC
CTGGGTACTGGTTCTTCTGTTCCATCTAAATACCGAAATGTCTCTGCCACACTGCTAAAGGTGCCTGGATATGGC
TACTATCTGCTTGACTGTGGTGAGAATACTCTTGGTCAACTGAAGCGAGTTTTCGAGCCCGAAGAACTTCGTGAA
GTGCTTCAGAACCTGCGAATGATTTGGATCAGCCACTTGCACGCTGATCACCACCTAGGAACGGTCTCTGTGATC
AAGGCCTGGCACGCAGAGAACTTCAAGGATGGATTTGGCTCGGCTGCTAGACGTGAAAACGACATAGCCAAGATC
CTCCAGGAGAAACGGCTGGCACTTGTGTCTGATGATGCAATGATATCCTGGTTGGAAGAATACTCACAGGTCGAG
AACTTCGGGTTCGACAAGTTGCTTACTCTTTCCGCGCATCCCGAAGTACAAGGTTCTAAAATCACCACCGAGTTC
TCACACCAACTACCTAATCGTCATCGTCTTCATGTTGATTTCACGGACGAATCCTCCCCCATCACTCCTCTTCTC
AAGTCTGCCACCGGCCTTGCAGACATACTCACTTGCCGTGTCAAACACTGCAAGGGTGCGCTCGCCGTCTCCCTT
GTCTTCTCAAATGGATTCAAGGTTTCCTACTCCGGTGACTGCAGGCCATCAGATAAATTTGCCGCCATTGGACAG
GGTTCGACCGTGCTTATCCATGAGGCCACCTTCCAACCCGACATGGTCGGATCGGCTAGGGCCAAACGGCACTCG
ACCTCCTCCGAGGCAATCGAAATTGGCCGCCGCATGCAAGCGCGCGCTGTCCTGCTCACTCATTTCAGCCAACGC
TACCAGAAGATAGCGTTTGTAGAGAAGCAAAATCCAGGCAAATTCCCGAATAACCGGGATGCAGCTGCAAAGGAG
CCCGCAGATGCGGATATCCCATTCGACGACCCCCAGGATGAATCAGCGGGCAACGACGCCCCAATGTCCGACGAC
ATCAACATGACGACATCAAGCCAAAGGCTCGGCGTCTATACCGGCCCCGTCGCGGGAGCGATGGACTTCATGCGT
ATCAAGGTCGGGGACTTCGCCCTTGCGCAAGCATATGCGCCAGCGTTGGAGAAGCTGGTCGAGCTCTTGGAGCGA
GCGGCGAACGAGGAATCCGAGCGCGTGAAACTGATGCGCCAGGAAGAGGAGAATGCCCGCAAGGCGAAGAATAAT
AAGAAGTTGGCTAAGCAAATGGCTACTGCTACGGCTGCGGCAGCTGCGGCTGCATTGACTGAGACTAGCGATGTC
CCGGCGGTGCCCACTCGATCTGTCTGGAGTGCCAGTGAAAGCGAGGAGGGGTGGGAGACGAGTGACCACGAGGAA
TGTTGTTCCTAA
Gene >Pro_DTO377G3_2|g855.t1
ATGGCGACTCTCGCAGACCATCCTATGCAACCAGTGGCCAACTACGACCAGGATCTCGACTCATTCATCAACTTT
GATCAACTCACCTACACATCTGATCCCTCTCGCTCCAAGGTTATGGTCAGCCAACCATCGGTCGCAAGTACAGAG
TTCAGCGCCAGTGACGCCCGCAGTGCCAGCTTTGCCTCAAGTGGCCAGTCTCCTCTAGCATACCAGGCCCCAAGC
CACCAATACGACGAACACAGACAACAGACTGGTCTCCCACCAGGTGCTTTGTCCATGTCTTACAGCCAGGTCCCG
ATGGGTTTCAACAACGGTCAAGTATTTCCCGTGAACGCTGAAGTGTATGCTGGTCATCACATGAAGCGCGAGGAC
GCACAATTTGACTTCAACACCGCACCGGGCCGGAACCCATCGGAGATGGAGATTGATCCCGAAACCATGAATCCT
TCGCCATACTTCTACCCCGCAAACCCTGGCACCAAGAGCCAATATGTCGATCCCAACGCTCTCGGAGGCCATGAG
CTGGCTCAGGCTGGTCCGTCCACACAAGTCGGTCGCATGTACCCTGGCATGCATCAGCAGCAGGCTGCGATGGCC
AAGGCACAGCAACAAAAGCAAATTGAGATGGTCCGTCCTCAGATACAGCAGCGTCCGGATCAAGTGGGCCATGCT
ATTTCTCAGGTCCGCGGTCCCCGTAACCCCGACCCCGTCGTCGAGGAGCGTATCTCTCGTCTACTTCAACAGATG
CGACAGAATGCCATGGCCAATGGCGAGGGCTCCCCCAGCCCTTCCAATGGTATGCCGCAGATGGCCAAGGCCCGG
AAGGATGAGGCCGATATGGATGAAGACGAGCGTCTTCTCGCTAGCGAAGAGGGCAAAAAGCTCAGCAGCAAGGAG
CGCCGCCAGTTGCGGAACAAGGTTTCCGCTCGCGCTTTCCGATCTCGCCGCAAGGGTATGACTATCTGAACACTC
GAATACGTATGTGATGTTCTTTTTGCTAACACATCTCCAGAATACATTGGTCAGCTCGAAAGTGAGGTGGCCGCT
AGAACCAACGAGGCGCACGAAATTCGCCTCCAGAACCGCGCTCTTTACGAAGAAAATGCCCGCCTGAACGACTTG
GCCCGCATGCTCCTGGGATCTCCCCATTTCTCCAACTTCCTGAACGACATGGGTGACACCCTGCCCGCTCAACCT
CAACAGCAATCTCAACAACCCCAGCAACAGCAACAAGTTCAGCAGGCTGCACCCAACATGCAGGCTATGCCTAAG
GACTCGAACGCCAACCGTGGTCAAGAGTTCCAGATGCAGCAGAACCCCCAGCCCAACATGGTCATGGTTTCAAAC
CAGGGTATGGACCACTCCAGCATGGGCATGAACAACGCCGGCTGGAACTCAGGAATCGACATGAACTACGGTAAC
ACTCCCGTATTTGCTGTCATGGAGGTTCCCGAGGGCCCGGCCCTCGATGTCGAAGCTCTGTCCGGAAAATCCTCT
TCTTCCTTCAGCCTCCCCGAGAGCTCTAAGAATGAAGCTCCTGTTGTCGAGCGTTCTGCTAGCGACTCATTCAGC
CAGTCTGACATTGGTGTTGTCAACCCTGATGTTGAGATTGATGAGTCCGATCCTGCCTTTGCTCTCTTTGTTGAT
TCTCCTGCGCCCGCTGCCGACCTCACATTCGAGGGTGTTTCGACCGAGAAGAATGCTCAGTTCCAACTCGTCATT
GACAGCTCTGAAGTCAGCGATTCGGCCAAGAGAACCTTCAACGCCCTTTGCAACAGCATTGACGCTGCCTTCGAG
CGTGTCTCAGCTGTTACGTCCCACCTTCAGTGATTCCCCATTAGCGTCCTGCCTTTTCGGCCTTCTTTTCTTTGT
ATATGTGAGCCCTATTCTCTTTCTCGCCATTGTCATTGCCTTGTGACTATACACCTACGGTGAAACCTCCTGCCA
TATTTTGCGAATCATGGGAGGGAGTTTTTATTTCCTTTGTCTGTCCTGGGGGAGTTTCAAGGCGCCTGTCTCTTA
CTATATCGTGTATCTCCCACGAGGGACCTTCTTGATGGAATTTTGGAGCTTACTTTACTGGCGTATCTAAAGAAT
TTGTGGAGTAAAAGCCCAACTCTTGATATTTACGGCCATATGATTGTCTTGTTTATTGCATAGCCTGTATACTTG
TAGTAGTTTAGCCAAATAGAATGCGTGTCACTTTGTCAAAATGGTATGCGTTGGAAGTTCCAACCCGGTACATAA
CTAGAACATGTAAATTGAATATCAGGTACTTGTTTAATAGCACAAGTATTTCTTAAATGCGCATCTACACTTAAA
TCTAGCTGAGCTATCTGTTGTGCTATTTATTTGAAGAACAACTCCATGGCGGTCCAGATGGATTTTCTGCCCGGC
CATGCGAAAAATTGACCGTCACTTTTTTCTCTAAACGTTGGAATCCACCAATTTCCTACTCCTTGACATCACTAC
ACATGCGCGCCTTTTATCATAAATTTCTATTTCGATACCCCTCATTCTAGCCAAGTTGGCTTCCTCTTGCGTGCG
CGGTGTCCTGTCAACCGCGACCACTCGCGCAGTCGCCTGGCGCGCATTCTCTCGAACCTCAATTTCGCCATTCAC
CCTACGATCGTATCGCAGCGCCAGAAGCCGTGACTCACCAAAACCCGGTGACTCAAAGCCGAGCTCCAGTAGCCC
CATCCCTTTCCCTAAATCATTGGAGCAATTAGCGGAAAAAAAGAAATTGCAAGAGCAAGCCTTGCCGCTTCGGAT
CAGACAACCTGCAATCAAAGAGAACGCATACTTTCTTCAAGCCCCGGCCTTGAACAGACGACGGCCCGATAACGA
CGACTACTTGATTTGTGAACCATCCAAACTCGAACTCGTTCCATTGCCTATACCGGTAGAAGGAATTGCCCCGAT
GAAATTCTTCTACCAGGTCATCACGACCCCAACGGCCGATACCCCCGGCACGGCCGTTTGCCTCAACTTCCCAGA
CAAGCGATACTTCTTCGGCCAGGTATCAGAAGGCACACAGCGTGCATGCACAGAGCGCGGGATCAAGCTATCTCT
TCTCACCGATGTCTTTGTCACTGGACGGACGGAATGGGCCAACACAGGCGGTTTGATTGGGATTGTTCTGACCCT
TGCTGATACGGTGGCATCTTCCATGGCGGCTATTGAGGACGAACAAAGAAAGAAGGCTGCCCGCAGGGCGGAACG
GGAGGCCGAAGAAAATACAAAATCTAAGCCCCGTGCACCCCAAAATGGTAGGACCCCTGCCCCTGCCCTTGTGGA
GCGGGACGGCGAGACGGTCTCGCAGCGAGGTAACCTCACCATTCATGGTGCTGCAAATCTTACACATACACTGGC
TACGTCTCGACGGTTTGTTTTCCGAAAGGGCATGCCGGTGTATTTGAAAGAATATGACTCGGAAACCCTCGCTAA
GCAAATGCCTATCGGCGCCGAGGATCCCTTTGAGAAGCCATCATGGTCCGACAGTAACATCAAAGTCTGGGCTCT
GCCTATTAAACCTCACCCATCGGCGCGTTCTCCAGTTACGCAGCCGTTGTCACAGAGTCCACGAAAGCGGAGCTT
GGACGAGTTCCAGGAATCTGAACAGACCGGAGATCATATGGACCAACGTACTAAGAACTTGATGGTGACGCAGTC
TATTGTGCAGGATATGTTTAACTCAACGTGGAAGATGGATGCCCTCCATGAAACCCCATTGGCTGAGGTCAAGAT
GCCGGCCGCCATATTCATTCGCAACCCAGAAACCAAGGACCTTGAACAATACAAAGGTCCGGTGCCGGGTGGCTC
AGATGAGCTGCCAGACATCAAGGTGCTCGTTCGAAAGCCCTGGCCCGGTGCTACTATCGAGAGTCTCCCAACCAC
TTCTCCCTCGAAAGAGGCTGTCTGCTATATCGTGCGAAACCACGATATCCGCGGAAAGTTCGACCCGAAGAAGGC
CCGAGAATTGAACGTTGAGAAGGGTTCTAAGTACGCGGCTTTGACGAAGGGCGAGAGCGTTCAATCCCTAGATGG
CAAGACTATCACTCCAGATATGGTCTTGGGACAGACGCGAGCAGGAAAAGGCGTTGCCATCATGGAATTGCCATC
GTCTGATTACGTCGAGGACCTGGTAAACCGGCCCGAATGGAAGTCACCAGCCGTGACGACCGAGTTGCAGGCCTT
CATCTGGATTCTTGGACCAGGCGTGGCTGAGAATCCTAAATTCCAGGAATTCGTTGCCAGCATGTCCCACTGCAA
GCACACCGTGTCGAGCACAGACCACTGCCCGAACTACCTGGCATTGACCTGCTCTGCTAGCTCGACTGTTCGCCT
CGCCCGTCTGAAAAGCGATAGCTATGCGGTTCCTGTTCACGACAATGTGACCCTTCCCCAACCGGGCTCACCTAA
TGCCAATTCACAATCTGCAATTGCTGCTCGCCAGAATTCTCCACTGCAGCCTCTTGTACCCGGATTCATCATCAA
CATGGAGCCCAATTTCGGGTTCAACAGTGAGGATGTGATGACCCGCTTCAACCCAGCGAATGTATTGAATAGCAT
CCCGCGTTCTGTTACACAAAGAATGGAAGTCATTAGCAGCCGCGTGGCTAAACCTGCTTTCCAGAAAAAGTTGCA
CGAGCAACGGACACAATGGCCTGGAGCGGATGCAGAAATCATCGCCCTGGGTACTGGTTCTTCTGTTCCATCTAA
ATACCGAAATGTCTCTGCCACACTGCTAAAGGTGCCTGGATATGGCTACTATCTGCTTGACTGTGGTGAGAATAC
TCTTGGTCAACTGAAGCGAGTTTTCGAGCCCGAAGAACTTCGTGAAGTGCTTCAGAACCTGCGAATGATTTGGAT
CAGCCACTTGCACGCTGATCACCACCTAGGAACGGTCTCTGTGATCAAGGCCTGGCACGCAGAGAACTTCAAGGA
TGGATTTGGCTCGGCTGCTAGACGTGAAAACGACATAGCCAAGATCCTCCAGGAGAAACGGCTGGCACTTGTGTC
TGATGATGCAATGATATCCTGGTTGGAAGAATACTCACAGGTCGAGAACTTCGGGTTCGACAAGTTGCTTACTCT
TTCCGCGCATCCCGAAGTACAAGGTTCTAAAATCACCACCGAGTTCTCACACCAACTACCTAATCGTCATCGTCT
TCATGTTGATTTCACGGACGAATCCTCCCCCATCACTCCTCTTCTCAAGTCTGCCACCGGCCTTGCAGACATACT
CACTTGCCGTGTCAAACACTGCAAGGGTGCGCTCGCCGTCTCCCTTGTCTTCTCAAATGGATTCAAGGTTTCCTA
CTCCGGTGACTGCAGGCCATCAGATAAATTTGCCGCCATTGGACAGGGTTCGACCGTGCTTATCCATGAGGCCAC
CTTCCAACCCGACATGGTCGGATCGGCTAGGGCCAAACGGCACTCGACCTCCTCCGAGGCAATCGAAATTGGCCG
CCGCATGCAAGCGCGCGCTGTCCTGCTCACTCATTTCAGCCAACGCTACCAGAAGATAGCGTTTGTAGAGAAGCA
AAATCCAGGCAAATTCCCGAATAACCGGGATGCAGCTGCAAAGGAGCCCGCAGATGCGGATATCCCATTCGACGA
CCCCCAGGATGAATCAGCGGGCAACGACGCCCCAATGTCCGACGACATCAACATGACGACATCAAGCCAAAGGCT
CGGCGTCTATACCGGCCCCGTCGCGGGAGCGATGGACTTCATGCGTATCAAGGTCGGGGACTTCGCCCTTGCGCA
AGCATATGCGCCAGCGTTGGAGAAGCTGGTCGAGCTCTTGGAGCGAGCGGCGAACGAGGAATCCGAGCGCGTGAA
ACTGATGCGCCAGGAAGAGGAGAATGCCCGCAAGGCGAAGAATAATAAGAAGTTGGCTAAGCAAATGGCTACTGC
TACGGCTGCGGCAGCTGCGGCTGCATTGACTGAGACTAGCGATGTCCCGGCGGTGCCCACTCGATCTGTCTGGAG
TGCCAGTGAAAGCGAGGAGGGGTGGGAGACGAGTGACCACGAGGAATGTTGTTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail