Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8547.t1
Gene name
Locationscaffold_34:121305..125121
Strand+
Gene length (bp)3816
Transcript length (bp)3648
Coding sequence length (bp)3648
Protein length (aa) 1216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.8E-08 557 689
PF00004 AAA ATPase family associated with various cellular activities (AAA) 3.4E-43 876 1002
PF09262 PEX-1N Peroxisome biogenesis factor 1, N-terminal 2.6E-29 129 218
PF17862 AAA_lid_3 AAA+ lid domain 8.1E-08 1034 1063

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0007031 peroxisome organization Yes
GO:0005777 peroxisome Yes
GO:0043227 membrane-bounded organelle No
GO:0016043 cellular component organization No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0044444 cytoplasmic part No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0009987 cellular process No
GO:0044464 cell part No
GO:0043226 organelle No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0043231 intracellular membrane-bounded organelle No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0042579 microbody No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0044424 intracellular part No
GO:0005488 binding No
GO:0006996 organelle organization No
GO:0036094 small molecule binding No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8547.t1
MAPKKPAATAEVALIPLKNCLVNLPPSLVALLVNANTTAQNVIIELQYKSTSGKANGAPPQQSCFLGWTGMPSKR
RLAPVVGRDGINSGYSREQEVSTVELDTTFGRLLGLTEGQKVGLFIHLDPPVAHTINIEPLTPEDWEIIELHATF
LELNLLSQIRALPNPTYNAAQSMHMHPLALHLSPTSTANIVVTSLTPAPPDTSPFAKIAPDAEVIVAPKVRSKTS
KSSRADSRSATGSSRRSAGGRSASSTVRPKSGRSDSSTRGSLYLRGVDRSATTQYFDEEVEDDANQGLRIWVDPD
LLASHELRGATWACVSVVQPSGLKPPPDPQQQLAQAEQQKSNDSGAPATKLVAKLFPWEEAPDNRHVALSTLLCT
ALGAENMVGGIIRVEAAPPPLHRSAVKTLKVYPFIGDSLKKKDGLKFGADTTASRDALAERLKVIYGSTGSDTGL
FSGPLTDGMIIPKSDYHPSVSSFDGAIIRFDPPLKGAPDETKSMFGWLLGSEAKLNLEVQAEIPKPFDPSSQALP
MEDPLPETAPELVGIDSLIEQSLNNLTKSSSILLTGGLGAGKTALAHLLAHRLRRDHLFNVKYFSCRKLVTDETR
ISNIKETLNRLFMSASWCARLGGQSVVILEDLDKLCPAETELQVGGDNGRSRQNSEVICSMVREYCALNSSVVLL
ATAQAKESLNNVIIGGHVVREIINMRSPDKEGRRKVLEKLTSEDKPTESLNGHVRATSSSTQDSWLDPSNPGSRP
SSSGGDGFVIGRDVEYLELAGKTDGYMPGDLVLLVARARNEALIRSVSDLTATSKMITLGLEDFESALKDFTPAS
LRNVTLTSSTTTFSSVGGLFETRKMLLETLQYPTKYAPIFAQCPLRLRSGLLLYGFPGCGKTMLASAVAGECGLN
FISVKGPEILNKYIGASEKSVRDLFERAQAARPCVLFFDEFDSIAPKRGHDSTGVTDRVVNQLLTQMDGAEGLSG
VYVLAATSRPDLIDPALLRPGRLDKSLLCGMPNHADRVDIIRSVSEKLKMSDEVTSRFGDIATQTEGFSGADLQA
VVYNAHLEAVHDTLGDRSTDAAKPNSKSNSSANASSKSFIQFLYSSSEEASGSVSMPAPAVISAKLEAIKNSRRR
QRQLEQGLSGANNAAAPVANGTEPDADELHEDIIVRWEHVERSLATTRGSLPPAELRRLQGIYREFVAGRNGEMP
NGEAANEIGGRTSLM*
Coding >Pro_DTO377G3_2|g8547.t1
ATGGCGCCCAAGAAGCCTGCTGCGACGGCCGAAGTCGCCCTTATCCCCCTAAAGAACTGTCTTGTTAATCTACCG
CCGTCGCTGGTCGCCCTGCTGGTCAATGCAAACACGACTGCTCAGAATGTTATTATCGAATTACAATATAAATCG
ACCTCCGGAAAGGCCAATGGAGCTCCTCCGCAGCAATCATGCTTCCTCGGTTGGACGGGTATGCCGAGCAAGCGC
AGGCTTGCGCCTGTCGTTGGGAGGGACGGTATCAACAGTGGATATTCCAGGGAGCAGGAAGTATCCACCGTTGAG
CTTGATACTACTTTTGGGCGACTCCTTGGTCTCACAGAAGGCCAGAAGGTCGGATTGTTCATCCACCTCGATCCA
CCCGTTGCACATACGATAAACATCGAGCCATTGACACCAGAAGACTGGGAGATCATTGAGCTCCATGCCACATTC
CTGGAGCTTAACCTCTTGTCACAAATTCGCGCTCTACCCAATCCTACATACAATGCGGCTCAATCGATGCATATG
CACCCACTCGCATTGCATCTCTCTCCCACATCTACCGCCAATATTGTCGTCACTTCTCTTACACCCGCTCCCCCA
GATACCTCCCCCTTCGCCAAAATCGCGCCGGATGCAGAAGTCATAGTGGCTCCCAAGGTTCGATCTAAGACGAGT
AAAAGCTCTCGGGCTGACAGCCGCAGCGCTACTGGTAGCAGCAGGAGGAGTGCTGGTGGGAGGAGTGCTTCGAGC
ACTGTACGCCCGAAGAGTGGTCGGTCCGACTCCAGTACACGAGGCTCCCTCTACTTGAGAGGCGTAGACCGCTCA
GCGACCACTCAATATTTTGACGAGGAAGTAGAAGATGACGCAAATCAGGGCCTTCGTATTTGGGTTGATCCGGAT
CTGCTGGCTAGCCATGAGCTGCGCGGAGCGACTTGGGCATGCGTGTCGGTTGTCCAGCCATCCGGTCTCAAACCC
CCACCAGATCCCCAACAGCAACTTGCTCAGGCTGAACAGCAAAAGTCCAATGATTCTGGTGCCCCTGCAACCAAG
CTCGTGGCTAAATTGTTTCCATGGGAGGAGGCTCCTGACAATCGGCATGTGGCGCTTTCCACCTTGTTGTGCACG
GCCCTTGGTGCAGAGAACATGGTTGGAGGAATCATCCGAGTTGAAGCAGCACCCCCACCACTGCATCGCTCGGCA
GTCAAGACCCTCAAAGTCTATCCTTTCATAGGCGACTCTTTAAAGAAGAAGGACGGGCTGAAGTTCGGTGCCGAC
ACTACGGCATCTCGCGATGCCCTAGCCGAGCGCCTCAAAGTCATCTACGGCAGCACTGGGTCCGACACAGGGCTG
TTCTCGGGACCTTTGACTGATGGAATGATTATACCCAAATCTGACTATCACCCTTCAGTCTCTTCGTTCGATGGT
GCTATTATTCGCTTTGATCCCCCTTTGAAGGGAGCTCCTGACGAAACAAAGTCAATGTTTGGGTGGTTGCTAGGC
TCCGAAGCCAAGCTGAATCTTGAAGTGCAGGCTGAAATCCCCAAGCCATTTGACCCTAGTTCGCAGGCGCTACCT
ATGGAGGACCCTCTTCCAGAAACTGCCCCTGAATTAGTAGGGATTGATTCTCTCATTGAACAGTCATTGAACAAT
CTAACAAAGTCGTCGTCTATCTTGCTGACCGGTGGTCTTGGTGCCGGTAAAACAGCTCTTGCCCATCTACTGGCT
CATCGCCTAAGACGAGATCATCTCTTCAATGTCAAGTATTTCTCCTGCCGCAAGCTCGTGACAGATGAAACACGT
ATTTCCAACATCAAAGAGACCTTGAATCGCCTCTTCATGTCCGCATCATGGTGTGCGCGTCTTGGTGGCCAGTCA
GTCGTGATCCTTGAAGACCTTGACAAGCTCTGCCCAGCGGAGACTGAATTACAGGTGGGTGGTGACAATGGCCGC
AGTCGCCAGAACAGCGAGGTTATCTGCTCTATGGTTCGAGAATATTGCGCGCTGAATTCCTCTGTTGTGCTACTG
GCCACTGCACAGGCCAAAGAGTCCCTCAATAATGTTATTATAGGCGGCCATGTCGTCCGTGAGATCATCAATATG
AGATCCCCTGATAAGGAAGGACGCCGAAAGGTTTTGGAAAAACTTACTAGCGAAGATAAACCCACGGAGAGCTTA
AATGGGCATGTGAGGGCCACAAGCTCCTCAACACAAGATTCATGGTTGGACCCTTCAAATCCGGGGAGCCGACCA
AGCTCTTCTGGGGGTGATGGATTTGTTATTGGAAGGGATGTCGAGTATCTAGAACTGGCCGGCAAAACCGATGGG
TATATGCCCGGTGATCTTGTGCTTCTCGTTGCTCGTGCGCGGAATGAGGCCCTCATTCGCTCTGTCTCAGATCTG
ACAGCAACATCGAAGATGATCACTCTAGGGTTAGAGGACTTTGAAAGTGCCTTGAAGGACTTTACCCCAGCGTCT
CTTCGAAATGTTACTCTTACCTCGTCAACAACCACATTTTCGTCTGTTGGAGGTTTGTTTGAAACTCGCAAGATG
CTGTTGGAAACTTTGCAGTATCCTACAAAATATGCCCCGATCTTCGCACAGTGCCCATTGCGACTGCGGTCTGGT
TTACTTCTCTATGGATTCCCTGGATGCGGTAAGACAATGTTGGCTAGCGCAGTGGCTGGCGAATGTGGATTGAAC
TTCATCAGTGTCAAGGGTCCCGAGATTTTGAACAAATATATCGGAGCCAGTGAAAAGAGTGTTCGCGATTTGTTT
GAAAGAGCCCAAGCCGCTCGCCCTTGCGTCCTTTTCTTTGATGAGTTCGACAGTATCGCACCCAAGCGTGGGCAT
GACTCCACTGGTGTCACAGACCGTGTTGTCAACCAGTTGTTGACACAAATGGACGGCGCAGAAGGCCTCTCTGGC
GTTTATGTGCTGGCAGCAACATCACGACCCGACTTGATCGATCCTGCCCTCCTTCGTCCCGGCCGTCTCGACAAG
TCCCTTCTTTGCGGCATGCCCAACCATGCAGACCGTGTTGATATCATCCGATCTGTGAGTGAAAAGCTCAAGATG
AGTGACGAAGTCACGTCTCGCTTTGGTGATATTGCCACCCAGACCGAAGGATTCTCTGGTGCAGATCTGCAGGCT
GTCGTGTATAACGCCCATCTAGAGGCAGTCCACGACACGCTAGGTGACCGTTCTACCGATGCAGCGAAGCCCAAT
TCCAAGTCCAACTCCTCCGCCAATGCTTCTAGCAAGTCCTTCATCCAGTTCCTCTATTCCTCTTCAGAGGAAGCA
TCTGGGTCTGTCTCCATGCCAGCCCCAGCAGTGATTTCAGCCAAGCTAGAGGCAATCAAGAACTCACGTCGCCGC
CAGCGCCAGCTCGAGCAGGGACTTTCCGGTGCGAACAACGCCGCGGCCCCGGTGGCTAACGGCACTGAGCCCGAT
GCAGACGAGCTGCATGAGGATATCATCGTCCGCTGGGAACATGTTGAGCGCTCATTGGCAACCACGCGTGGTTCC
CTTCCCCCAGCTGAGCTTAGACGTCTCCAAGGAATCTACCGTGAGTTTGTGGCCGGCCGAAATGGCGAGATGCCC
AACGGCGAGGCTGCCAATGAGATTGGAGGGCGAACAAGTCTGATGTGA
Transcript >Pro_DTO377G3_2|g8547.t1
ATGGCGCCCAAGAAGCCTGCTGCGACGGCCGAAGTCGCCCTTATCCCCCTAAAGAACTGTCTTGTTAATCTACCG
CCGTCGCTGGTCGCCCTGCTGGTCAATGCAAACACGACTGCTCAGAATGTTATTATCGAATTACAATATAAATCG
ACCTCCGGAAAGGCCAATGGAGCTCCTCCGCAGCAATCATGCTTCCTCGGTTGGACGGGTATGCCGAGCAAGCGC
AGGCTTGCGCCTGTCGTTGGGAGGGACGGTATCAACAGTGGATATTCCAGGGAGCAGGAAGTATCCACCGTTGAG
CTTGATACTACTTTTGGGCGACTCCTTGGTCTCACAGAAGGCCAGAAGGTCGGATTGTTCATCCACCTCGATCCA
CCCGTTGCACATACGATAAACATCGAGCCATTGACACCAGAAGACTGGGAGATCATTGAGCTCCATGCCACATTC
CTGGAGCTTAACCTCTTGTCACAAATTCGCGCTCTACCCAATCCTACATACAATGCGGCTCAATCGATGCATATG
CACCCACTCGCATTGCATCTCTCTCCCACATCTACCGCCAATATTGTCGTCACTTCTCTTACACCCGCTCCCCCA
GATACCTCCCCCTTCGCCAAAATCGCGCCGGATGCAGAAGTCATAGTGGCTCCCAAGGTTCGATCTAAGACGAGT
AAAAGCTCTCGGGCTGACAGCCGCAGCGCTACTGGTAGCAGCAGGAGGAGTGCTGGTGGGAGGAGTGCTTCGAGC
ACTGTACGCCCGAAGAGTGGTCGGTCCGACTCCAGTACACGAGGCTCCCTCTACTTGAGAGGCGTAGACCGCTCA
GCGACCACTCAATATTTTGACGAGGAAGTAGAAGATGACGCAAATCAGGGCCTTCGTATTTGGGTTGATCCGGAT
CTGCTGGCTAGCCATGAGCTGCGCGGAGCGACTTGGGCATGCGTGTCGGTTGTCCAGCCATCCGGTCTCAAACCC
CCACCAGATCCCCAACAGCAACTTGCTCAGGCTGAACAGCAAAAGTCCAATGATTCTGGTGCCCCTGCAACCAAG
CTCGTGGCTAAATTGTTTCCATGGGAGGAGGCTCCTGACAATCGGCATGTGGCGCTTTCCACCTTGTTGTGCACG
GCCCTTGGTGCAGAGAACATGGTTGGAGGAATCATCCGAGTTGAAGCAGCACCCCCACCACTGCATCGCTCGGCA
GTCAAGACCCTCAAAGTCTATCCTTTCATAGGCGACTCTTTAAAGAAGAAGGACGGGCTGAAGTTCGGTGCCGAC
ACTACGGCATCTCGCGATGCCCTAGCCGAGCGCCTCAAAGTCATCTACGGCAGCACTGGGTCCGACACAGGGCTG
TTCTCGGGACCTTTGACTGATGGAATGATTATACCCAAATCTGACTATCACCCTTCAGTCTCTTCGTTCGATGGT
GCTATTATTCGCTTTGATCCCCCTTTGAAGGGAGCTCCTGACGAAACAAAGTCAATGTTTGGGTGGTTGCTAGGC
TCCGAAGCCAAGCTGAATCTTGAAGTGCAGGCTGAAATCCCCAAGCCATTTGACCCTAGTTCGCAGGCGCTACCT
ATGGAGGACCCTCTTCCAGAAACTGCCCCTGAATTAGTAGGGATTGATTCTCTCATTGAACAGTCATTGAACAAT
CTAACAAAGTCGTCGTCTATCTTGCTGACCGGTGGTCTTGGTGCCGGTAAAACAGCTCTTGCCCATCTACTGGCT
CATCGCCTAAGACGAGATCATCTCTTCAATGTCAAGTATTTCTCCTGCCGCAAGCTCGTGACAGATGAAACACGT
ATTTCCAACATCAAAGAGACCTTGAATCGCCTCTTCATGTCCGCATCATGGTGTGCGCGTCTTGGTGGCCAGTCA
GTCGTGATCCTTGAAGACCTTGACAAGCTCTGCCCAGCGGAGACTGAATTACAGGTGGGTGGTGACAATGGCCGC
AGTCGCCAGAACAGCGAGGTTATCTGCTCTATGGTTCGAGAATATTGCGCGCTGAATTCCTCTGTTGTGCTACTG
GCCACTGCACAGGCCAAAGAGTCCCTCAATAATGTTATTATAGGCGGCCATGTCGTCCGTGAGATCATCAATATG
AGATCCCCTGATAAGGAAGGACGCCGAAAGGTTTTGGAAAAACTTACTAGCGAAGATAAACCCACGGAGAGCTTA
AATGGGCATGTGAGGGCCACAAGCTCCTCAACACAAGATTCATGGTTGGACCCTTCAAATCCGGGGAGCCGACCA
AGCTCTTCTGGGGGTGATGGATTTGTTATTGGAAGGGATGTCGAGTATCTAGAACTGGCCGGCAAAACCGATGGG
TATATGCCCGGTGATCTTGTGCTTCTCGTTGCTCGTGCGCGGAATGAGGCCCTCATTCGCTCTGTCTCAGATCTG
ACAGCAACATCGAAGATGATCACTCTAGGGTTAGAGGACTTTGAAAGTGCCTTGAAGGACTTTACCCCAGCGTCT
CTTCGAAATGTTACTCTTACCTCGTCAACAACCACATTTTCGTCTGTTGGAGGTTTGTTTGAAACTCGCAAGATG
CTGTTGGAAACTTTGCAGTATCCTACAAAATATGCCCCGATCTTCGCACAGTGCCCATTGCGACTGCGGTCTGGT
TTACTTCTCTATGGATTCCCTGGATGCGGTAAGACAATGTTGGCTAGCGCAGTGGCTGGCGAATGTGGATTGAAC
TTCATCAGTGTCAAGGGTCCCGAGATTTTGAACAAATATATCGGAGCCAGTGAAAAGAGTGTTCGCGATTTGTTT
GAAAGAGCCCAAGCCGCTCGCCCTTGCGTCCTTTTCTTTGATGAGTTCGACAGTATCGCACCCAAGCGTGGGCAT
GACTCCACTGGTGTCACAGACCGTGTTGTCAACCAGTTGTTGACACAAATGGACGGCGCAGAAGGCCTCTCTGGC
GTTTATGTGCTGGCAGCAACATCACGACCCGACTTGATCGATCCTGCCCTCCTTCGTCCCGGCCGTCTCGACAAG
TCCCTTCTTTGCGGCATGCCCAACCATGCAGACCGTGTTGATATCATCCGATCTGTGAGTGAAAAGCTCAAGATG
AGTGACGAAGTCACGTCTCGCTTTGGTGATATTGCCACCCAGACCGAAGGATTCTCTGGTGCAGATCTGCAGGCT
GTCGTGTATAACGCCCATCTAGAGGCAGTCCACGACACGCTAGGTGACCGTTCTACCGATGCAGCGAAGCCCAAT
TCCAAGTCCAACTCCTCCGCCAATGCTTCTAGCAAGTCCTTCATCCAGTTCCTCTATTCCTCTTCAGAGGAAGCA
TCTGGGTCTGTCTCCATGCCAGCCCCAGCAGTGATTTCAGCCAAGCTAGAGGCAATCAAGAACTCACGTCGCCGC
CAGCGCCAGCTCGAGCAGGGACTTTCCGGTGCGAACAACGCCGCGGCCCCGGTGGCTAACGGCACTGAGCCCGAT
GCAGACGAGCTGCATGAGGATATCATCGTCCGCTGGGAACATGTTGAGCGCTCATTGGCAACCACGCGTGGTTCC
CTTCCCCCAGCTGAGCTTAGACGTCTCCAAGGAATCTACCGTGAGTTTGTGGCCGGCCGAAATGGCGAGATGCCC
AACGGCGAGGCTGCCAATGAGATTGGAGGGCGAACAAGTCTGATGTGA
Gene >Pro_DTO377G3_2|g8547.t1
ATGGCGCCCAAGAAGCCTGCTGCGACGGCCGAAGTCGCCCTTATCCCCCTAAAGAACTGTCTTGTTAATCTACCG
CCGTCGCTGGTCGCCCTGCTGGTCAATGCAAACACGGTCAGTCTGCTAGTTGTTCTGTTTCCGTAGGTTATCTTC
GGCTAACTTCTAGCTATAACAGACTGCTCAGAATGTTATTATCGAATTACAATATAAATCGACCTCCGGAAAGGC
CAATGGAGCTCCTCCGCAGCAATCATGCTTCCTCGGTTGGACGGGTATGCCGAGCAAGCGCAGGCTTGCGCCTGT
CGTTGGGAGGGACGGTATCAACAGTGGATATTCCAGGGAGCAGGAAGTATCCACCGTTGAGCTTGATACTACTTT
TGGGCGACTCCTTGGTCTCACAGAAGGCCAGAAGGTACAATACTCCCCGTGCGTCATTACCCACGTGGGGCGCTA
ACACTTGCAGGTCGGATTGTTCATCCACCTCGATCCACCCGTTGCACATACGATAAACATCGAGCCATTGACACC
AGAAGACTGGGAGAGTATGTACAAGCTACAAGCAGCTATAATTAGAGTGGTACTTACTCGATATAACCAGTCATT
GAGCTCCATGCCACATTCCTGGAGCTTAACCTCTTGTCACAAATTCGCGCTCTACCCAATCCTACATACAATGCG
GCTCAATCGATGCATATGCACCCACTCGCATTGCATCTCTCTCCCACATCTACCGCCAATATTGTCGTCACTTCT
CTTACACCCGCTCCCCCAGATACCTCCCCCTTCGCCAAAATCGCGCCGGATGCAGAAGTCATAGTGGCTCCCAAG
GTTCGATCTAAGACGAGTAAAAGCTCTCGGGCTGACAGCCGCAGCGCTACTGGTAGCAGCAGGAGGAGTGCTGGT
GGGAGGAGTGCTTCGAGCACTGTACGCCCGAAGAGTGGTCGGTCCGACTCCAGTACACGAGGCTCCCTCTACTTG
AGAGGCGTAGACCGCTCAGCGACCACTCAATATTTTGACGAGGAAGTAGAAGATGACGCAAATCAGGGCCTTCGT
ATTTGGGTTGATCCGGATCTGCTGGCTAGCCATGAGCTGCGCGGAGCGACTTGGGCATGCGTGTCGGTTGTCCAG
CCATCCGGTCTCAAACCCCCACCAGATCCCCAACAGCAACTTGCTCAGGCTGAACAGCAAAAGTCCAATGATTCT
GGTGCCCCTGCAACCAAGCTCGTGGCTAAATTGTTTCCATGGGAGGAGGCTCCTGACAATCGGCATGTGGCGCTT
TCCACCTTGTTGTGCACGGCCCTTGGTGCAGAGAACATGGTTGGAGGAATCATCCGAGTTGAAGCAGCACCCCCA
CCACTGCATCGCTCGGCAGTCAAGACCCTCAAAGTCTATCCTTTCATAGGCGACTCTTTAAAGAAGAAGGACGGG
CTGAAGTTCGGTGCCGACACTACGGCATCTCGCGATGCCCTAGCCGAGCGCCTCAAAGTCATCTACGGCAGCACT
GGGTCCGACACAGGGCTGTTCTCGGGACCTTTGACTGATGGAATGATTATACCCAAATCTGACTATCACCCTTCA
GTCTCTTCGTTCGATGGTGCTATTATTCGCTTTGATCCCCCTTTGAAGGGAGCTCCTGACGAAACAAAGTCAATG
TTTGGGTGGTTGCTAGGCTCCGAAGCCAAGCTGAATCTTGAAGTGCAGGCTGAAATCCCCAAGCCATTTGACCCT
AGTTCGCAGGCGCTACCTATGGAGGACCCTCTTCCAGAAACTGCCCCTGAATTAGTAGGGATTGATTCTCTCATT
GAACAGTCATTGAACAATCTAACAAAGTCGTCGTCTATCTTGCTGACCGGTGGTCTTGGTGCCGGTAAAACAGCT
CTTGCCCATCTACTGGCTCATCGCCTAAGACGAGATCATCTCTTCAATGTCAAGTATTTCTCCTGCCGCAAGCTC
GTGACAGATGAAACACGTATTTCCAACATCAAAGAGACCTTGAATCGCCTCTTCATGTCCGCATCATGGTGTGCG
CGTCTTGGTGGCCAGTCAGTCGTGATCCTTGAAGACCTTGACAAGCTCTGCCCAGCGGAGACTGAATTACAGGTG
GGTGGTGACAATGGCCGCAGTCGCCAGAACAGCGAGGTTATCTGCTCTATGGTTCGAGAATATTGCGCGCTGAAT
TCCTCTGTTGTGCTACTGGCCACTGCACAGGCCAAAGAGTCCCTCAATAATGTTATTATAGGCGGCCATGTCGTC
CGTGAGATCATCAATATGAGATCCCCTGATAAGGAAGGACGCCGAAAGGTTTTGGAAAAACTTACTAGCGAAGAT
AAACCCACGGAGAGCTTAAATGGGCATGTGAGGGCCACAAGCTCCTCAACACAAGATTCATGGTTGGACCCTTCA
AATCCGGGGAGCCGACCAAGCTCTTCTGGGGGTGATGGATTTGTTATTGGAAGGGATGTCGAGTATCTAGAACTG
GCCGGCAAAACCGATGGGTATATGCCCGGTGATCTTGTGCTTCTCGTTGCTCGTGCGCGGAATGAGGCCCTCATT
CGCTCTGTCTCAGATCTGACAGCAACATCGAAGATGATCACTCTAGGGTTAGAGGACTTTGAAAGTGCCTTGAAG
GACTTTACCCCAGCGTCTCTTCGAAATGTTACTCTTACCTCGTCAACAACCACATTTTCGTCTGTTGGAGGTTTG
TTTGAAACTCGCAAGATGCTGTTGGAAACTTTGCAGTATCCTACAAAATATGCCCCGATCTTCGCACAGTGCCCA
TTGCGACTGCGGTCTGGTTTACTTCTCTATGGATTCCCTGGATGCGGTAAGACAATGTTGGCTAGCGCAGTGGCT
GGCGAATGTGGATTGAACTTCATCAGTGTCAAGGGTCCCGAGATTTTGAACAAATATATCGGAGCCAGTGAAAAG
AGTGTTCGCGATTTGTTTGAAAGAGCCCAAGCCGCTCGCCCTTGCGTCCTTTTCTTTGATGAGTTCGACAGTATC
GCACCCAAGCGTGGGCATGACTCCACTGGTGTCACAGACCGTGTTGTCAACCAGTTGTTGACACAAATGGACGGC
GCAGAAGGCCTCTCTGGCGTTTATGTGCTGGCAGCAACATCACGACCCGACTTGATCGATCCTGCCCTCCTTCGT
CCCGGCCGTCTCGACAAGTCCCTTCTTTGCGGCATGCCCAACCATGCAGACCGTGTTGATATCATCCGATCTGTG
AGTGAAAAGCTCAAGATGAGTGACGAAGTCACGTCTCGCTTTGGTGATATTGCCACCCAGACCGAAGGATTCTCT
GGTGCAGATCTGCAGGCTGTCGTGTATAACGCCCATCTAGAGGCAGTCCACGACACGCTAGGTGACCGTTCTACC
GATGCAGCGAAGCCCAATTCCAAGTCCAACTCCTCCGCCAATGCTTCTAGCAAGTCCTTCATCCAGTTCCTCTAT
TCCTCTTCAGAGGAAGCATCTGGGTCTGTCTCCATGCCAGCCCCAGCAGTGATTTCAGCCAAGCTAGAGGCAATC
AAGAACTCACGTCGCCGCCAGCGCCAGCTCGAGCAGGGACTTTCCGGTGCGAACAACGCCGCGGCCCCGGTGGCT
AACGGCACTGAGCCCGATGCAGACGAGCTGCATGAGGATATCATCGTCCGCTGGGAACATGTTGAGCGCTCATTG
GCAACCACGCGTGGTTCCCTTCCCCCAGCTGAGCTTAGACGTCTCCAAGGAATCTACCGTGAGTTTGTGGCCGGC
CGAAATGGCGAGATGCCCAACGGCGAGGCTGCCAATGAGATTGGAGGGCGAACAAGTCTGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail