Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8532.t1
Gene name
Locationscaffold_34:89554..91468
Strand+
Gene length (bp)1914
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.9E-23 80 497

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 108 127 19
3 139 158 19
4 168 190 22
5 197 214 17
6 227 249 22
7 284 306 22
8 311 333 22
9 353 375 22
10 390 412 22
11 419 438 19
12 448 470 22
13 483 505 22
14 560 577 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8532.t1
MGVSRFRSAFRRSSTQDSVTQIPVTTDGDEKSKIPTDPVAVPNSADPEVPTQDAQQGVRDVEAVTLSWTRTMLIA
VFANIWFLYFVNAMQSSINYSLLSYVTSDFESHSLLNVIYIVADAMTASVYIPTAKIMDVWGRAEGFLVMTVFAT
LGLILMAVCHNLPTFCAAYVFYSIGFGGMTYCVDVITADISKLKNRGLAYAFTSSPYIITAFAGPKAAEGFYEDI
SWRWAFGAFSIIFPIVASPLYFILKSNLKKAQKNGLLVPEPSGRNWWQSIWHYTKEFDLLGVLVFSTGLTIFLLP
FSIATYAPKGWASGYIIAMIVIGFVMLGLFLVWEFRFAPTPMFNFRLLTDRTIIGACLLDATYQLSYYCWNNYYT
SFLQVVNDLTISEAGYVSNTFDVVSGFLLLGVGFIIRKTGRFKWTLYIGVPLYIFAQGLMIYFRQPDQSVGYLVM
CQIFISIGGSVFIIVEQLAILAAADHQHVATVLALLNVVGTVGDAAGSTICAAIWTNTFYKALEARLPASAIGDI
DLIYEDITQQLSYPVGTPARRAIQSAYAYSQTRMLAVGTGLMGLCIIWAIMIRDIDLKKVAQVKGVVF*
Coding >Pro_DTO377G3_2|g8532.t1
ATGGGTGTTTCCAGGTTCCGATCTGCCTTCCGGCGATCATCGACCCAGGACTCTGTTACTCAAATCCCTGTGACC
ACTGATGGCGATGAAAAGAGCAAAATCCCTACCGACCCCGTTGCTGTACCCAACAGCGCGGACCCCGAAGTTCCC
ACTCAAGATGCACAGCAAGGTGTCAGGGATGTCGAGGCTGTGACTTTGAGTTGGACGAGGACCATGCTGATTGCA
GTCTTTGCAAACATCTGGTTCTTGTACTTCGTCAATGCTATGCAATCCTCGATTAACTACAGTTTGCTCAGCTAT
GTCACCAGTGACTTTGAGAGTCATTCCCTCCTGAATGTCATCTACATTGTTGCAGACGCCATGACAGCCTCAGTG
TACATCCCCACTGCCAAGATCATGGACGTTTGGGGCCGTGCAGAGGGTTTCCTGGTCATGACCGTTTTTGCTACG
CTTGGTCTAATTCTCATGGCTGTATGCCACAACCTTCCCACATTCTGCGCGGCCTACGTCTTCTACAGCATTGGA
TTCGGAGGTATGACATACTGTGTCGATGTCATCACCGCCGACATTTCCAAGCTCAAGAATCGAGGTTTGGCTTAC
GCTTTCACCTCCTCGCCATACATCATCACAGCCTTCGCTGGTCCCAAGGCCGCCGAGGGCTTCTACGAAGACATT
AGCTGGCGATGGGCCTTTGGTGCATTCTCCATCATCTTCCCTATTGTTGCCTCCCCTCTTTACTTCATCTTGAAG
AGCAACCTCAAGAAGGCCCAGAAGAACGGTCTTCTAGTCCCGGAGCCTAGCGGCCGGAATTGGTGGCAAAGCATT
TGGCACTATACCAAAGAGTTCGATTTGCTTGGTGTTTTGGTGTTCTCTACCGGCCTTACAATCTTCCTCCTTCCG
TTCAGCATTGCAACGTACGCCCCTAAGGGCTGGGCATCAGGCTACATCATTGCTATGATCGTCATCGGATTTGTT
ATGCTTGGCCTCTTCCTTGTTTGGGAGTTCCGCTTTGCTCCGACACCAATGTTCAACTTCAGACTGTTGACCGAT
CGAACCATCATTGGTGCATGCTTGCTCGACGCGACATACCAGCTCTCTTACTACTGCTGGAACAACTACTATACA
TCCTTTTTGCAGGTAGTCAACGATCTCACCATCTCCGAGGCCGGTTATGTTAGCAACACTTTCGACGTTGTCTCC
GGCTTCCTCTTGCTTGGAGTCGGTTTCATTATTCGCAAGACTGGTCGCTTTAAGTGGACTCTCTACATTGGTGTC
CCGCTTTACATCTTCGCCCAGGGATTGATGATCTATTTCCGCCAGCCCGACCAATCTGTCGGTTATCTTGTGATG
TGTCAGATTTTCATCTCCATTGGTGGATCTGTCTTCATCATTGTCGAGCAGCTTGCCATCTTAGCTGCCGCCGAT
CACCAGCACGTCGCAACTGTCCTCGCCCTTCTGAACGTCGTCGGTACCGTGGGTGATGCTGCCGGTTCTACCATT
TGTGCCGCAATCTGGACCAACACCTTCTACAAAGCCCTTGAGGCGAGGCTTCCTGCCTCTGCGATAGGAGACATC
GATTTGATCTACGAGGATATTACCCAGCAGCTGTCCTATCCCGTCGGAACCCCCGCGAGAAGGGCTATTCAATCA
GCCTATGCCTATTCTCAGACACGAATGCTTGCTGTTGGCACCGGTCTCATGGGTCTTTGCATCATCTGGGCCATC
ATGATCCGCGACATTGACCTCAAGAAGGTTGCTCAGGTCAAGGGTGTCGTCTTCTAA
Transcript >Pro_DTO377G3_2|g8532.t1
ATGGGTGTTTCCAGGTTCCGATCTGCCTTCCGGCGATCATCGACCCAGGACTCTGTTACTCAAATCCCTGTGACC
ACTGATGGCGATGAAAAGAGCAAAATCCCTACCGACCCCGTTGCTGTACCCAACAGCGCGGACCCCGAAGTTCCC
ACTCAAGATGCACAGCAAGGTGTCAGGGATGTCGAGGCTGTGACTTTGAGTTGGACGAGGACCATGCTGATTGCA
GTCTTTGCAAACATCTGGTTCTTGTACTTCGTCAATGCTATGCAATCCTCGATTAACTACAGTTTGCTCAGCTAT
GTCACCAGTGACTTTGAGAGTCATTCCCTCCTGAATGTCATCTACATTGTTGCAGACGCCATGACAGCCTCAGTG
TACATCCCCACTGCCAAGATCATGGACGTTTGGGGCCGTGCAGAGGGTTTCCTGGTCATGACCGTTTTTGCTACG
CTTGGTCTAATTCTCATGGCTGTATGCCACAACCTTCCCACATTCTGCGCGGCCTACGTCTTCTACAGCATTGGA
TTCGGAGGTATGACATACTGTGTCGATGTCATCACCGCCGACATTTCCAAGCTCAAGAATCGAGGTTTGGCTTAC
GCTTTCACCTCCTCGCCATACATCATCACAGCCTTCGCTGGTCCCAAGGCCGCCGAGGGCTTCTACGAAGACATT
AGCTGGCGATGGGCCTTTGGTGCATTCTCCATCATCTTCCCTATTGTTGCCTCCCCTCTTTACTTCATCTTGAAG
AGCAACCTCAAGAAGGCCCAGAAGAACGGTCTTCTAGTCCCGGAGCCTAGCGGCCGGAATTGGTGGCAAAGCATT
TGGCACTATACCAAAGAGTTCGATTTGCTTGGTGTTTTGGTGTTCTCTACCGGCCTTACAATCTTCCTCCTTCCG
TTCAGCATTGCAACGTACGCCCCTAAGGGCTGGGCATCAGGCTACATCATTGCTATGATCGTCATCGGATTTGTT
ATGCTTGGCCTCTTCCTTGTTTGGGAGTTCCGCTTTGCTCCGACACCAATGTTCAACTTCAGACTGTTGACCGAT
CGAACCATCATTGGTGCATGCTTGCTCGACGCGACATACCAGCTCTCTTACTACTGCTGGAACAACTACTATACA
TCCTTTTTGCAGGTAGTCAACGATCTCACCATCTCCGAGGCCGGTTATGTTAGCAACACTTTCGACGTTGTCTCC
GGCTTCCTCTTGCTTGGAGTCGGTTTCATTATTCGCAAGACTGGTCGCTTTAAGTGGACTCTCTACATTGGTGTC
CCGCTTTACATCTTCGCCCAGGGATTGATGATCTATTTCCGCCAGCCCGACCAATCTGTCGGTTATCTTGTGATG
TGTCAGATTTTCATCTCCATTGGTGGATCTGTCTTCATCATTGTCGAGCAGCTTGCCATCTTAGCTGCCGCCGAT
CACCAGCACGTCGCAACTGTCCTCGCCCTTCTGAACGTCGTCGGTACCGTGGGTGATGCTGCCGGTTCTACCATT
TGTGCCGCAATCTGGACCAACACCTTCTACAAAGCCCTTGAGGCGAGGCTTCCTGCCTCTGCGATAGGAGACATC
GATTTGATCTACGAGGATATTACCCAGCAGCTGTCCTATCCCGTCGGAACCCCCGCGAGAAGGGCTATTCAATCA
GCCTATGCCTATTCTCAGACACGAATGCTTGCTGTTGGCACCGGTCTCATGGGTCTTTGCATCATCTGGGCCATC
ATGATCCGCGACATTGACCTCAAGAAGGTTGCTCAGGTCAAGGGTGTCGTCTTCTAA
Gene >Pro_DTO377G3_2|g8532.t1
ATGGGTGTTTCCAGGTTCCGATCTGCCTTCCGGCGATCATCGACCCAGGACTCTGTTACTCAAATCCCTGTGACC
ACTGATGGCGATGAAAAGAGCAAAATCCCTACCGACCCCGTTGCTGTACCCAACAGCGCGGACCCCGAAGTTCCC
ACTCAAGATGCACAGCAAGGTGTCAGGGATGTCGAGGCTGTGACTTTGAGTTGGACGAGGACCATGCTGATTGCA
GTCTTTGCAAAGTAAGCTTTTGTTCCCTCGCCTCGACGGGCGATCGACCCGTAAAAACCAGCTTATTTACTAACG
TGAATCTTCAATAGCATCTGGTTCTTGTACTTCGTCAATGCTATGCAATCCTCGATTAACTACAGTTTGCTCAGC
TATGTCACCAGTGACTTTGAGAGTCATTCCCTCCTGAATGTCATCTACATTGTTGCAGACGCCATGACAGCCTCA
GTGTACATCCCCACTGCCAAGATCATGGACGTTTGGGGCCGTGCAGAGGGTTTCCTGGTCATGACCGTTTTTGCT
ACGCTTGGTCTAATTCTCATGGCTGTATGCCACAACCTTCCCACATTCTGCGCGGCCTACGTCTTCTACAGCATT
GGATTCGGAGGTATGACATACTGTGTCGATGTCATCACCGCCGACATTTCCAAGCTCAAGAATCGAGGTTTGGCT
TACGCTTTCACCTCCTCGCCATACATCATCACAGCCTTCGCTGGTCCCAAGGCCGCCGAGGGCTTCTACGAAGAC
ATTAGCTGGCGATGGGCCTTTGGTGCATTCTCCATCATCTTCCCTATTGTTGCCTCCCCTCTTTACTTCATCTTG
AAGAGCAACCTCAAGAAGGCCCAGAAGAACGGTCTTCTAGTCCCGGAGCCTAGCGGCCGGAATTGGTGGCAAAGC
ATTTGGCACTATACCAAAGAGTTCGATTGTGAGTGAAGAGCTTTTCAAAGCATTGGAAAATTGGGAATACTGACT
TGAATAGTGCTTGGTGTTTTGGTGTTCTCTACCGGCCTTACAATCTTCCTCCTTCCGTTCAGCATTGCAACGTAC
GCCCCTAAGGGCTGGGCATCAGGCTACATCATTGCTATGATCGTCATCGGATTTGTTATGCTTGGCCTCTTCCTT
GTTTGGGAGTTCCGCTTTGCTCCGACACCAATGTTCAACTTCAGACTGTTGACCGATCGAACCATCATTGGTGCA
TGCTTGCTCGACGCGACATACCAGCTCTCTTACTACTGCTGGAACAACTACTATACATCCTTTTTGCAGGTAGTC
AACGATCTCACCATCTCCGAGGCCGGTTATGTTAGCAACACTTTCGACGTTGTCTCCGGCTTCCTCTTGCTTGGA
GTCGGTTTCATTATTCGCAAGACTGGTCGCTTTAAGTGGACTCTCTACATTGGTGTCCCGCTTTACATCTTCGCC
CAGGGATTGATGATCTATTTCCGCCAGCCCGACCAATCTGTCGGTTATCTTGTGATGTGTCAGATTTTCATCTCC
ATTGGTGGATCTGTCTTCATCATTGTCGAGCAGCTTGCCATCTTAGCTGCCGCCGATCACCAGCACGTCGCAACT
GTCCTCGCCCTTCTGAACGTCGTCGGTACCGTGGGTGATGCTGCCGGTTCTACCATTTGTGCCGCAATCTGGACC
AACACCTTCTACAAAGCCCTTGAGGCGAGGCTTCCTGCCTCTGCGATAGGAGACATCGATTTGATCTACGAGGAT
ATTACCCAGCAGCTGTCCTATCCCGTCGGAACCCCCGCGAGAAGGGCTATTCAATCAGCCTATGCCTATTCTCAG
ACACGAATGCTTGCTGTTGGCACCGGTCTCATGGGTCTTTGCATCATCTGGGCCATCATGATCCGCGACATTGAC
CTCAAGAAGGTTGCTCAGGTCAAGGGTGTCGTCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail