Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8531.t1
Gene name
Locationscaffold_34:87574..88444
Strand+
Gene length (bp)870
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 3.0E-52 20 269
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 4.0E-22 24 191

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.49 0.88 8.10
5d_25C Five days - 25 degrees Celsius 1.46 0.00 3.12
7d_25C Seven days - 25 degrees Celsius 1.39 0.00 2.84
10d_25C Ten days - 25 degrees Celsius 1.65 0.00 3.33
7d_15C Seven days - 15 degrees Celsius 0.18 0.00 0.53
7d_30C Seven days - 30 degrees Celsius 4.66 0.84 8.48

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.048648 yes
3d_25C 7d_25C 0.023429 yes
3d_25C 7d_15C 0.110690 no
3d_25C 7d_30C 0.959418 no
3d_25C 10d_25C 0.048648 yes
5d_25C 7d_25C 0.956705 no
5d_25C 7d_15C 0.129833 no
5d_25C 7d_30C 0.047134 yes
5d_25C 10d_25C 0.893972 no
7d_25C 7d_15C 0.141294 no
7d_25C 7d_30C 0.018295 yes
7d_25C 10d_25C 0.830577 no
7d_15C 7d_30C 0.101429 no
7d_15C 10d_25C 0.110283 no
7d_30C 10d_25C 0.039986 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8531.t1
MSLRSGPLNHENFYISFPHERIVQVTINRPDKLNCIDKKTSREIAKIWEQFDEDESLWVAIITGVGRAFCTGADL
GEWNAMNKAGVVNDMSAPGLAGLPRRTGKKPIIAAVNGLCMGGGFEMVANCDLILASSSAIFSLPEVKRGIVPVA
GCLPRLTRTIGLQRTMDLVLTGRNVSATTLHDWGLISQVVEPPADVVRAAIEVAEVMCKNSPDSLIVGRLGVRMS
WEAGSVEDTVTDLADHWYPRLVGGPNFAEGIQAFVEKRSPSWKNSKL*
Coding >Pro_DTO377G3_2|g8531.t1
ATGTCGTTACGATCAGGGCCCTTGAATCATGAGAATTTCTATATCTCTTTCCCGCATGAGCGGATTGTCCAGGTC
ACAATCAATAGACCGGACAAGCTAAATTGCATCGACAAGAAGACTAGTCGAGAGATTGCCAAGATCTGGGAGCAG
TTCGATGAAGATGAAAGCTTATGGGTCGCCATCATCACCGGTGTTGGGAGAGCCTTCTGCACAGGCGCAGATCTA
GGAGAGTGGAACGCAATGAACAAGGCAGGCGTCGTCAATGACATGTCCGCTCCTGGCCTGGCCGGATTGCCTCGC
CGGACCGGCAAGAAACCGATCATCGCCGCAGTGAACGGCCTCTGCATGGGCGGAGGGTTCGAGATGGTGGCGAAT
TGCGATCTTATCTTAGCCTCATCATCGGCCATTTTCTCCCTTCCCGAAGTGAAGCGAGGCATCGTGCCAGTAGCC
GGATGTTTACCGCGATTGACCCGCACTATTGGCCTACAACGCACCATGGATCTCGTGCTTACTGGCAGGAACGTG
AGCGCCACCACGCTACATGACTGGGGTCTTATCAGTCAAGTGGTGGAGCCACCAGCCGACGTTGTCCGAGCAGCA
ATTGAAGTTGCTGAGGTCATGTGCAAGAATAGCCCTGATTCCCTCATTGTTGGCCGTCTAGGTGTTCGAATGAGC
TGGGAAGCTGGCAGCGTGGAGGATACTGTAACAGATCTCGCGGATCACTGGTATCCTCGGTTGGTTGGGGGTCCT
AACTTTGCCGAAGGCATCCAGGCTTTTGTGGAGAAACGATCACCAAGCTGGAAGAATTCAAAACTGTGA
Transcript >Pro_DTO377G3_2|g8531.t1
ATGTCGTTACGATCAGGGCCCTTGAATCATGAGAATTTCTATATCTCTTTCCCGCATGAGCGGATTGTCCAGGTC
ACAATCAATAGACCGGACAAGCTAAATTGCATCGACAAGAAGACTAGTCGAGAGATTGCCAAGATCTGGGAGCAG
TTCGATGAAGATGAAAGCTTATGGGTCGCCATCATCACCGGTGTTGGGAGAGCCTTCTGCACAGGCGCAGATCTA
GGAGAGTGGAACGCAATGAACAAGGCAGGCGTCGTCAATGACATGTCCGCTCCTGGCCTGGCCGGATTGCCTCGC
CGGACCGGCAAGAAACCGATCATCGCCGCAGTGAACGGCCTCTGCATGGGCGGAGGGTTCGAGATGGTGGCGAAT
TGCGATCTTATCTTAGCCTCATCATCGGCCATTTTCTCCCTTCCCGAAGTGAAGCGAGGCATCGTGCCAGTAGCC
GGATGTTTACCGCGATTGACCCGCACTATTGGCCTACAACGCACCATGGATCTCGTGCTTACTGGCAGGAACGTG
AGCGCCACCACGCTACATGACTGGGGTCTTATCAGTCAAGTGGTGGAGCCACCAGCCGACGTTGTCCGAGCAGCA
ATTGAAGTTGCTGAGGTCATGTGCAAGAATAGCCCTGATTCCCTCATTGTTGGCCGTCTAGGTGTTCGAATGAGC
TGGGAAGCTGGCAGCGTGGAGGATACTGTAACAGATCTCGCGGATCACTGGTATCCTCGGTTGGTTGGGGGTCCT
AACTTTGCCGAAGGCATCCAGGCTTTTGTGGAGAAACGATCACCAAGCTGGAAGAATTCAAAACTGTGA
Gene >Pro_DTO377G3_2|g8531.t1
ATGTCGTTACGATCAGGGCCCTTGAATCATGAGAATTTCTATATCTCTTTCCCGCATGAGCGGATTGTCCAGGTC
ACAATCAATAGACCGGACAAGCTAAATTGCATCGACAAGAAGACTAGTCGAGAGATTGCCAAGATCTGGGAGCAG
TTCGATGAAGATGAAAGCTTATGGGTCGCCATCATCACCGGTGTTGGGAGAGCCTTCTGCACAGGCGCAGATCTA
GGAGGTGGGTTTCTTCTTTCTATCACCTGAACTATCGACTGACGGAATCGAGCAGAGTGGAACGCAATGAACAAG
GCAGGCGTCGTCAATGACATGTCCGCTCCTGGCCTGGCCGGATTGCCTCGCCGGACCGGCAAGAAACCGATCATC
GCCGCAGTGAACGGCCTCTGCATGGGCGGAGGGTTCGAGATGGTGGCGAATTGCGATCTTATCTTAGCCTCATCA
TCGGCCATTTTCTCCCTTCCCGAAGTGAAGCGAGGCATCGTGCCAGTAGCCGGATGTTTACCGCGATTGACCCGC
ACTATTGGCCTACAACGCACCATGGATCTCGTGCTTACTGGCAGGAACGTGAGCGCCACCACGCTACATGACTGG
GGTCTTATCAGTCAAGTGGTGGAGCCACCAGCCGACGTTGTCCGAGCAGCAATTGAAGTTGCTGAGGTCATGTGC
AAGAATAGCCCTGATTCCCTCATTGTTGGCCGTCTAGGTGTTCGAATGAGCTGGGAAGCTGGCAGCGTGGAGGAT
ACTGTAACAGATCTCGCGGATCACTGGTATCCTCGGTTGGTTGGGGGTCCTAACTTTGCCGAAGGCATCCAGGCT
TTTGTGGAGAAACGATCACCAAGCTGGAAGAATTCAAAACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail