Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8529.t1
Gene name
Locationscaffold_34:80766..84772
Strand-
Gene length (bp)4006
Transcript length (bp)3954
Coding sequence length (bp)3954
Protein length (aa) 1318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 1.2E-52 26 287
PF00664 ABC_membrane ABC transporter transmembrane region 8.3E-37 740 1010
PF00005 ABC_tran ABC transporter 1.2E-27 380 572
PF00005 ABC_tran ABC transporter 2.0E-30 1091 1243

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0016887 ATPase activity Yes
GO:0055085 transmembrane transport Yes
GO:0016462 pyrophosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0022804 active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0044425 membrane part No
GO:0005488 binding No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0042623 ATPase activity, coupled No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0030554 adenyl nucleotide binding No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 78 100 22
3 154 173 19
4 178 200 22
5 293 315 22
6 735 757 22
7 778 800 22
8 848 870 22
9 877 899 22
10 964 986 22
11 999 1021 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8529.t1
MGFGNLADYPRLLVAANPSRLELVTLFVGLASAIGSGVPFPIIGIVFGQLIDDFNSVTCAEAAGEQGDSSDQADI
NSRILLIVYLGIAQFVLIYLHLLCWTMTGARLAQRLREKYLQNLLRQEPSFFDNLPAGEVASRLNTDIQTIRSGT
AEKVGICISSFSFFVTAYVVAFIKDSILAAMLLSLIPAYFIMSFVGSYYIEKYTGRMSDYAASAASIASEALNNI
VVVHAFGANARLEEKFSKALKDSETEGLKKASATGIQAGVLYFVSYGANGLAFWQGSKQIAAAVRRESAGATVGA
IFTVIFVLVEATLLLSQVAPFIHLFTQAVACYHKLRSDIDRVSLIDGHSDEGIRLTEAEGGFELKDVSFIYPSRP
EITVLNKINLSIAPKKHTAIVGLSGSGKSTIAGLVIRLYDATGGEITFDGHNIRDVNTRDLRGFLSLVQQEPSLL
DRSLLENIAHGLMNSSKPAHAHLKMALLSTDLGDLATEVREGEDLMTAAERRGPEIVEIVQLVRHAAALADADGF
IEALQYGYATMVGSSGRLISGGQKQRVSLARALVKDPAVLILDEATAALDSRSEQRIQRAINNISTGRTVITIAH
RLSTITNADKIVCMHKGDILEEGTHAELMAANGPYSELVKLQTLGAAAGSKTDTTASIESVSKSDATSITDMENE
KGGLSHDHEPTKETRVSTTEAPAGDSDEEEEQNRDLQGPVRSVWGLCKGYAPALKPHTLVIFAALFGSSMVGGAF
SGEAVIFGNTVGSLNPCHTADSISSRGNFYGLMFFVLAIIEFFANIVSWGGFGLVSEKIVYKVRVLSFRSLFEQD
LQWHQSNGRSPALLLSYITRDGNALAGISGSVVGTLFSITVNLIAAIILTHIIAWRIALVCLALVPLLLGAGLME
LMVLGKFEERHENAYTKSVDIGVEAVTSIKTIASLSLEENTLRTYRRSLKGPRKETFMVTVQASFWQAMTYFLGN
MVNALAYWWGSKQIINGNYSQTQFLIVVFSLLVSALLWSQMFALAPELSAARSAMSRILGLIEIGKDKMGGRLNP
YTMDVEATEEKPTYNSGSTASSVQMRDVHFSYPARPDMKILKGLNIDIRPGKFCALVGPSGAGKSTIISLVERLY
KPESGSIIIDGVDVTKTSDVTFRDWISLVPQESVLFEGSIEFNVGLGARPNHKVTLEEIQEACKLANIHDVIAAL
PNGYQTLCGPSGNQFSGGQKQRLSIARALVRKPKLLILDESTSALDAESEKLLQDGLEKAARGITVIAIAHRLHT
IRKADTIFLIDGGVCTDSGSHEELLLRSDSYRANVMHQTVAT*
Coding >Pro_DTO377G3_2|g8529.t1
ATGGGTTTCGGGAACCTTGCAGACTACCCTCGGCTGCTTGTGGCTGCCAATCCCTCACGACTCGAATTGGTAACC
CTCTTTGTTGGCCTGGCGTCTGCAATTGGATCGGGTGTCCCTTTCCCCATCATTGGTATCGTATTCGGTCAACTT
ATCGATGATTTCAATTCGGTGACCTGTGCCGAAGCTGCTGGCGAGCAAGGGGACTCCAGCGATCAAGCGGACATC
AATAGCAGAATTCTGCTGATCGTGTACCTGGGCATTGCTCAATTCGTTTTAATCTACCTTCACCTACTATGCTGG
ACGATGACCGGTGCGCGCCTGGCGCAGCGACTCCGCGAAAAGTATCTCCAGAACCTGCTCCGACAAGAACCCTCT
TTCTTTGATAACCTGCCGGCCGGAGAAGTTGCTTCTCGACTCAATACCGATATCCAAACCATTCGCTCCGGTACA
GCTGAGAAGGTCGGAATCTGTATCTCGAGTTTCTCCTTTTTCGTCACCGCATACGTCGTGGCATTTATCAAAGAC
TCTATTCTTGCCGCGATGCTACTGTCCTTGATCCCCGCATACTTCATTATGTCATTTGTTGGAAGTTATTATATC
GAGAAATACACCGGGCGCATGTCGGATTATGCTGCTTCCGCTGCGTCGATTGCCTCCGAAGCGCTGAACAACATT
GTTGTGGTGCATGCATTTGGTGCCAACGCTCGTCTAGAGGAGAAGTTCTCCAAGGCGTTAAAGGACTCGGAAACC
GAAGGATTGAAAAAGGCGTCTGCCACTGGTATTCAAGCCGGTGTCTTGTATTTCGTCTCATATGGTGCAAACGGT
CTTGCATTCTGGCAAGGAAGTAAACAGATCGCCGCAGCAGTGCGCCGCGAGTCTGCGGGAGCCACTGTCGGAGCT
ATTTTCACGGTTATCTTTGTCTTGGTCGAAGCTACCCTGCTTCTGAGTCAAGTTGCACCTTTTATCCACCTGTTT
ACACAGGCTGTTGCCTGTTACCACAAGCTGCGAAGCGATATTGATCGTGTATCCTTGATTGATGGACACTCCGAT
GAGGGCATTCGCCTCACCGAGGCGGAGGGTGGATTTGAATTGAAGGACGTCTCTTTCATTTACCCCTCCAGGCCC
GAGATCACTGTCCTTAACAAGATCAATCTCTCTATTGCTCCCAAGAAGCACACTGCCATTGTTGGCCTTTCTGGA
AGTGGAAAGTCCACCATCGCAGGTTTGGTTATCCGCTTGTATGATGCCACGGGAGGTGAGATCACTTTCGATGGC
CACAATATCCGCGATGTCAATACCCGTGACTTGAGAGGATTCCTCAGTCTTGTGCAGCAGGAGCCTTCCCTTCTC
GACCGATCCCTTTTGGAGAACATCGCACACGGCTTGATGAACTCAAGCAAACCAGCCCATGCACACCTGAAGATG
GCACTCCTTTCAACGGACCTCGGTGATCTAGCCACCGAAGTCAGAGAGGGTGAAGATCTTATGACCGCAGCAGAG
AGACGGGGCCCAGAAATCGTCGAAATCGTTCAATTGGTCCGACATGCTGCCGCGCTTGCCGATGCAGATGGCTTT
ATCGAAGCATTGCAGTATGGGTACGCCACGATGGTTGGCTCTAGTGGTCGACTCATCAGTGGTGGTCAGAAGCAA
CGAGTCTCTCTTGCGCGTGCCCTTGTCAAGGATCCTGCGGTTCTCATTTTGGACGAAGCCACAGCTGCTCTGGAT
TCACGCAGTGAACAGCGTATCCAACGGGCTATCAACAACATCTCAACCGGTCGAACTGTTATCACGATTGCTCAT
CGTCTGTCAACGATCACAAATGCGGATAAGATTGTCTGTATGCACAAGGGAGATATCTTGGAAGAGGGAACTCAC
GCCGAGTTGATGGCTGCGAATGGGCCTTACTCTGAGCTGGTTAAATTGCAGACTCTCGGAGCTGCGGCTGGATCC
AAGACTGATACCACTGCCAGCATTGAGAGCGTCAGCAAGTCCGATGCTACCTCTATTACCGACATGGAAAATGAA
AAGGGCGGTCTTTCACATGACCATGAACCTACAAAGGAAACCCGTGTCTCAACCACTGAAGCACCAGCCGGTGAC
TCCGATGAGGAAGAGGAACAAAATAGAGACCTTCAGGGCCCCGTCAGATCCGTCTGGGGTCTTTGCAAGGGTTAT
GCTCCAGCTCTCAAGCCCCATACGCTTGTCATTTTTGCTGCTCTTTTCGGTTCCAGCATGGTTGGCGGAGCCTTC
TCTGGCGAAGCCGTCATTTTCGGAAACACGGTCGGAAGTCTCAACCCTTGTCACACTGCAGACAGCATCAGCTCA
CGGGGTAACTTCTACGGTCTGATGTTCTTCGTTCTTGCGATCATCGAGTTCTTTGCAAATATCGTCAGCTGGGGA
GGATTCGGCCTTGTCTCTGAGAAGATCGTCTATAAGGTGCGAGTGTTGTCATTCCGGTCACTGTTTGAACAAGAT
CTCCAGTGGCATCAGTCTAACGGCCGGTCGCCTGCTCTACTTCTGTCCTATATTACCAGAGATGGTAATGCCCTT
GCCGGTATTAGCGGATCTGTCGTTGGCACCCTGTTCTCTATCACCGTCAACCTCATTGCCGCCATTATTCTGACC
CACATTATTGCCTGGAGAATTGCCTTGGTCTGCCTGGCCCTTGTACCCCTTCTGCTTGGAGCTGGTCTAATGGAG
CTCATGGTCCTCGGCAAATTCGAGGAGCGTCATGAAAACGCTTACACCAAGTCTGTCGACATCGGTGTGGAAGCA
GTTACCTCTATCAAGACAATCGCCTCTCTTTCTCTTGAAGAGAATACTTTAAGGACCTACCGACGATCCCTGAAA
GGACCCCGCAAGGAGACATTTATGGTCACCGTGCAGGCAAGTTTCTGGCAAGCCATGACCTACTTCCTAGGTAAC
ATGGTAAATGCACTGGCATACTGGTGGGGTTCCAAGCAGATCATCAACGGCAACTACAGTCAGACCCAGTTCCTG
ATTGTCGTCTTCTCTCTCCTAGTCAGTGCCCTGCTTTGGAGTCAGATGTTCGCACTCGCACCTGAGCTTTCTGCC
GCGCGATCGGCAATGTCCAGAATCCTTGGCCTGATTGAGATCGGCAAGGACAAGATGGGTGGCCGGCTCAATCCA
TACACCATGGATGTCGAGGCAACTGAAGAGAAACCCACCTACAACTCGGGCAGCACGGCTTCGAGTGTGCAGATG
CGCGATGTTCACTTCTCTTACCCTGCCCGGCCGGACATGAAGATTCTGAAGGGCTTGAACATTGATATTCGCCCC
GGCAAGTTCTGTGCCCTCGTTGGACCCAGTGGTGCCGGTAAATCGACCATCATCTCCCTGGTTGAGCGCCTGTAC
AAACCCGAATCTGGCTCTATCATAATCGACGGAGTTGACGTGACCAAGACCTCGGATGTCACCTTCCGTGACTGG
ATTTCTCTTGTGCCTCAAGAGAGCGTCCTCTTCGAAGGAAGCATTGAGTTCAATGTTGGTCTCGGTGCCCGACCC
AACCACAAAGTGACCCTTGAAGAAATTCAAGAGGCCTGTAAGCTCGCAAACATCCACGATGTTATCGCTGCATTG
CCAAATGGCTACCAGACGCTCTGTGGACCGAGTGGTAACCAGTTCTCGGGAGGCCAGAAGCAGAGATTGTCCATC
GCTCGTGCTCTCGTTCGCAAGCCCAAGCTTCTCATTCTTGATGAATCGACTAGTGCTTTGGACGCTGAATCCGAG
AAGCTCTTGCAGGATGGTCTGGAAAAGGCCGCACGGGGAATCACTGTCATCGCCATTGCTCACCGTCTTCACACT
ATCCGGAAGGCTGATACCATTTTCTTGATCGATGGTGGTGTATGCACTGACTCTGGCTCTCATGAAGAATTGCTC
CTGCGGTCCGACAGTTACCGGGCGAATGTCATGCACCAGACAGTGGCGACTTGA
Transcript >Pro_DTO377G3_2|g8529.t1
ATGGGTTTCGGGAACCTTGCAGACTACCCTCGGCTGCTTGTGGCTGCCAATCCCTCACGACTCGAATTGGTAACC
CTCTTTGTTGGCCTGGCGTCTGCAATTGGATCGGGTGTCCCTTTCCCCATCATTGGTATCGTATTCGGTCAACTT
ATCGATGATTTCAATTCGGTGACCTGTGCCGAAGCTGCTGGCGAGCAAGGGGACTCCAGCGATCAAGCGGACATC
AATAGCAGAATTCTGCTGATCGTGTACCTGGGCATTGCTCAATTCGTTTTAATCTACCTTCACCTACTATGCTGG
ACGATGACCGGTGCGCGCCTGGCGCAGCGACTCCGCGAAAAGTATCTCCAGAACCTGCTCCGACAAGAACCCTCT
TTCTTTGATAACCTGCCGGCCGGAGAAGTTGCTTCTCGACTCAATACCGATATCCAAACCATTCGCTCCGGTACA
GCTGAGAAGGTCGGAATCTGTATCTCGAGTTTCTCCTTTTTCGTCACCGCATACGTCGTGGCATTTATCAAAGAC
TCTATTCTTGCCGCGATGCTACTGTCCTTGATCCCCGCATACTTCATTATGTCATTTGTTGGAAGTTATTATATC
GAGAAATACACCGGGCGCATGTCGGATTATGCTGCTTCCGCTGCGTCGATTGCCTCCGAAGCGCTGAACAACATT
GTTGTGGTGCATGCATTTGGTGCCAACGCTCGTCTAGAGGAGAAGTTCTCCAAGGCGTTAAAGGACTCGGAAACC
GAAGGATTGAAAAAGGCGTCTGCCACTGGTATTCAAGCCGGTGTCTTGTATTTCGTCTCATATGGTGCAAACGGT
CTTGCATTCTGGCAAGGAAGTAAACAGATCGCCGCAGCAGTGCGCCGCGAGTCTGCGGGAGCCACTGTCGGAGCT
ATTTTCACGGTTATCTTTGTCTTGGTCGAAGCTACCCTGCTTCTGAGTCAAGTTGCACCTTTTATCCACCTGTTT
ACACAGGCTGTTGCCTGTTACCACAAGCTGCGAAGCGATATTGATCGTGTATCCTTGATTGATGGACACTCCGAT
GAGGGCATTCGCCTCACCGAGGCGGAGGGTGGATTTGAATTGAAGGACGTCTCTTTCATTTACCCCTCCAGGCCC
GAGATCACTGTCCTTAACAAGATCAATCTCTCTATTGCTCCCAAGAAGCACACTGCCATTGTTGGCCTTTCTGGA
AGTGGAAAGTCCACCATCGCAGGTTTGGTTATCCGCTTGTATGATGCCACGGGAGGTGAGATCACTTTCGATGGC
CACAATATCCGCGATGTCAATACCCGTGACTTGAGAGGATTCCTCAGTCTTGTGCAGCAGGAGCCTTCCCTTCTC
GACCGATCCCTTTTGGAGAACATCGCACACGGCTTGATGAACTCAAGCAAACCAGCCCATGCACACCTGAAGATG
GCACTCCTTTCAACGGACCTCGGTGATCTAGCCACCGAAGTCAGAGAGGGTGAAGATCTTATGACCGCAGCAGAG
AGACGGGGCCCAGAAATCGTCGAAATCGTTCAATTGGTCCGACATGCTGCCGCGCTTGCCGATGCAGATGGCTTT
ATCGAAGCATTGCAGTATGGGTACGCCACGATGGTTGGCTCTAGTGGTCGACTCATCAGTGGTGGTCAGAAGCAA
CGAGTCTCTCTTGCGCGTGCCCTTGTCAAGGATCCTGCGGTTCTCATTTTGGACGAAGCCACAGCTGCTCTGGAT
TCACGCAGTGAACAGCGTATCCAACGGGCTATCAACAACATCTCAACCGGTCGAACTGTTATCACGATTGCTCAT
CGTCTGTCAACGATCACAAATGCGGATAAGATTGTCTGTATGCACAAGGGAGATATCTTGGAAGAGGGAACTCAC
GCCGAGTTGATGGCTGCGAATGGGCCTTACTCTGAGCTGGTTAAATTGCAGACTCTCGGAGCTGCGGCTGGATCC
AAGACTGATACCACTGCCAGCATTGAGAGCGTCAGCAAGTCCGATGCTACCTCTATTACCGACATGGAAAATGAA
AAGGGCGGTCTTTCACATGACCATGAACCTACAAAGGAAACCCGTGTCTCAACCACTGAAGCACCAGCCGGTGAC
TCCGATGAGGAAGAGGAACAAAATAGAGACCTTCAGGGCCCCGTCAGATCCGTCTGGGGTCTTTGCAAGGGTTAT
GCTCCAGCTCTCAAGCCCCATACGCTTGTCATTTTTGCTGCTCTTTTCGGTTCCAGCATGGTTGGCGGAGCCTTC
TCTGGCGAAGCCGTCATTTTCGGAAACACGGTCGGAAGTCTCAACCCTTGTCACACTGCAGACAGCATCAGCTCA
CGGGGTAACTTCTACGGTCTGATGTTCTTCGTTCTTGCGATCATCGAGTTCTTTGCAAATATCGTCAGCTGGGGA
GGATTCGGCCTTGTCTCTGAGAAGATCGTCTATAAGGTGCGAGTGTTGTCATTCCGGTCACTGTTTGAACAAGAT
CTCCAGTGGCATCAGTCTAACGGCCGGTCGCCTGCTCTACTTCTGTCCTATATTACCAGAGATGGTAATGCCCTT
GCCGGTATTAGCGGATCTGTCGTTGGCACCCTGTTCTCTATCACCGTCAACCTCATTGCCGCCATTATTCTGACC
CACATTATTGCCTGGAGAATTGCCTTGGTCTGCCTGGCCCTTGTACCCCTTCTGCTTGGAGCTGGTCTAATGGAG
CTCATGGTCCTCGGCAAATTCGAGGAGCGTCATGAAAACGCTTACACCAAGTCTGTCGACATCGGTGTGGAAGCA
GTTACCTCTATCAAGACAATCGCCTCTCTTTCTCTTGAAGAGAATACTTTAAGGACCTACCGACGATCCCTGAAA
GGACCCCGCAAGGAGACATTTATGGTCACCGTGCAGGCAAGTTTCTGGCAAGCCATGACCTACTTCCTAGGTAAC
ATGGTAAATGCACTGGCATACTGGTGGGGTTCCAAGCAGATCATCAACGGCAACTACAGTCAGACCCAGTTCCTG
ATTGTCGTCTTCTCTCTCCTAGTCAGTGCCCTGCTTTGGAGTCAGATGTTCGCACTCGCACCTGAGCTTTCTGCC
GCGCGATCGGCAATGTCCAGAATCCTTGGCCTGATTGAGATCGGCAAGGACAAGATGGGTGGCCGGCTCAATCCA
TACACCATGGATGTCGAGGCAACTGAAGAGAAACCCACCTACAACTCGGGCAGCACGGCTTCGAGTGTGCAGATG
CGCGATGTTCACTTCTCTTACCCTGCCCGGCCGGACATGAAGATTCTGAAGGGCTTGAACATTGATATTCGCCCC
GGCAAGTTCTGTGCCCTCGTTGGACCCAGTGGTGCCGGTAAATCGACCATCATCTCCCTGGTTGAGCGCCTGTAC
AAACCCGAATCTGGCTCTATCATAATCGACGGAGTTGACGTGACCAAGACCTCGGATGTCACCTTCCGTGACTGG
ATTTCTCTTGTGCCTCAAGAGAGCGTCCTCTTCGAAGGAAGCATTGAGTTCAATGTTGGTCTCGGTGCCCGACCC
AACCACAAAGTGACCCTTGAAGAAATTCAAGAGGCCTGTAAGCTCGCAAACATCCACGATGTTATCGCTGCATTG
CCAAATGGCTACCAGACGCTCTGTGGACCGAGTGGTAACCAGTTCTCGGGAGGCCAGAAGCAGAGATTGTCCATC
GCTCGTGCTCTCGTTCGCAAGCCCAAGCTTCTCATTCTTGATGAATCGACTAGTGCTTTGGACGCTGAATCCGAG
AAGCTCTTGCAGGATGGTCTGGAAAAGGCCGCACGGGGAATCACTGTCATCGCCATTGCTCACCGTCTTCACACT
ATCCGGAAGGCTGATACCATTTTCTTGATCGATGGTGGTGTATGCACTGACTCTGGCTCTCATGAAGAATTGCTC
CTGCGGTCCGACAGTTACCGGGCGAATGTCATGCACCAGACAGTGGCGACTTGA
Gene >Pro_DTO377G3_2|g8529.t1
ATGGGTTTCGGGAACCTTGCAGACTACCCTCGGCTGCTTGTGGCTGCCAATCCCTCACGACTCGAATTGGTAACC
CTCTTTGTTGGCCTGGCGTCTGCAATTGGATCGGGTGTCCCTTTCCCCATCATTGGTATCGTATTCGGTCAACTT
ATCGATGATTTCAATTCGGTGACCTGTGCCGAAGCTGCTGGCGAGCAAGGGGACTCCAGCGATCAAGCGGACATC
AATAGCAGAATTCTGCTGATCGTGTACCTGGGCATTGCTCAATTCGTTTTAATCTACCTTCACCTACTATGCTGG
ACGATGACCGGTGCGCGCCTGGCGCAGCGACTCCGCGAAAAGTATCTCCAGAACCTGCTCCGACAAGAACCCTCT
TTCTTTGATAACCTGCCGGCCGGAGAAGTTGCTTCTCGACTCAATACCGATATCCAAACCATTCGCTCCGGTACA
GCTGAGAAGGTCGGAATCTGTATCTCGAGTTTCTCCTTTTTCGTCACCGCATACGTCGTGGCATTTATCAAAGAC
TCTATTCTTGCCGCGATGCTACTGTCCTTGATCCCCGCATACTTCATTATGTCATTTGTTGGAAGTTATTATATC
GAGAAATACACCGGGCGCATGTCGGATTATGCTGCTTCCGCTGCGTCGATTGCCTCCGAAGCGCTGAACAACATT
GTTGTGGTGCATGCATTTGGTGCCAACGCTCGTCTAGAGGAGAAGTTCTCCAAGGCGTTAAAGGACTCGGAAACC
GAAGGATTGAAAAAGGCGTCTGCCACTGGTATTCAAGCCGGTGTCTTGTATTTCGTCTCATATGGTGCAAACGGT
CTTGCATTCTGGCAAGGAAGTAAACAGATCGCCGCAGCAGTGCGCCGCGAGTCTGCGGGAGCCACTGTCGGAGCT
ATTTTCACGGTTATCTTTGTCTTGGTCGAAGGTCAGTTTAATAGATATCTTGGTGTGAAATATTTTACTAACATT
AACGATAGCTACCCTGCTTCTGAGTCAAGTTGCACCTTTTATCCACCTGTTTACACAGGCTGTTGCCTGTTACCA
CAAGCTGCGAAGCGATATTGATCGTGTATCCTTGATTGATGGACACTCCGATGAGGGCATTCGCCTCACCGAGGC
GGAGGGTGGATTTGAATTGAAGGACGTCTCTTTCATTTACCCCTCCAGGCCCGAGATCACTGTCCTTAACAAGAT
CAATCTCTCTATTGCTCCCAAGAAGCACACTGCCATTGTTGGCCTTTCTGGAAGTGGAAAGTCCACCATCGCAGG
TTTGGTTATCCGCTTGTATGATGCCACGGGAGGTGAGATCACTTTCGATGGCCACAATATCCGCGATGTCAATAC
CCGTGACTTGAGAGGATTCCTCAGTCTTGTGCAGCAGGAGCCTTCCCTTCTCGACCGATCCCTTTTGGAGAACAT
CGCACACGGCTTGATGAACTCAAGCAAACCAGCCCATGCACACCTGAAGATGGCACTCCTTTCAACGGACCTCGG
TGATCTAGCCACCGAAGTCAGAGAGGGTGAAGATCTTATGACCGCAGCAGAGAGACGGGGCCCAGAAATCGTCGA
AATCGTTCAATTGGTCCGACATGCTGCCGCGCTTGCCGATGCAGATGGCTTTATCGAAGCATTGCAGTATGGGTA
CGCCACGATGGTTGGCTCTAGTGGTCGACTCATCAGTGGTGGTCAGAAGCAACGAGTCTCTCTTGCGCGTGCCCT
TGTCAAGGATCCTGCGGTTCTCATTTTGGACGAAGCCACAGCTGCTCTGGATTCACGCAGTGAACAGCGTATCCA
ACGGGCTATCAACAACATCTCAACCGGTCGAACTGTTATCACGATTGCTCATCGTCTGTCAACGATCACAAATGC
GGATAAGATTGTCTGTATGCACAAGGGAGATATCTTGGAAGAGGGAACTCACGCCGAGTTGATGGCTGCGAATGG
GCCTTACTCTGAGCTGGTTAAATTGCAGACTCTCGGAGCTGCGGCTGGATCCAAGACTGATACCACTGCCAGCAT
TGAGAGCGTCAGCAAGTCCGATGCTACCTCTATTACCGACATGGAAAATGAAAAGGGCGGTCTTTCACATGACCA
TGAACCTACAAAGGAAACCCGTGTCTCAACCACTGAAGCACCAGCCGGTGACTCCGATGAGGAAGAGGAACAAAA
TAGAGACCTTCAGGGCCCCGTCAGATCCGTCTGGGGTCTTTGCAAGGGTTATGCTCCAGCTCTCAAGCCCCATAC
GCTTGTCATTTTTGCTGCTCTTTTCGGTTCCAGCATGGTTGGCGGAGCCTTCTCTGGCGAAGCCGTCATTTTCGG
AAACACGGTCGGAAGTCTCAACCCTTGTCACACTGCAGACAGCATCAGCTCACGGGGTAACTTCTACGGTCTGAT
GTTCTTCGTTCTTGCGATCATCGAGTTCTTTGCAAATATCGTCAGCTGGGGAGGATTCGGCCTTGTCTCTGAGAA
GATCGTCTATAAGGTGCGAGTGTTGTCATTCCGGTCACTGTTTGAACAAGATCTCCAGTGGCATCAGTCTAACGG
CCGGTCGCCTGCTCTACTTCTGTCCTATATTACCAGAGATGGTAATGCCCTTGCCGGTATTAGCGGATCTGTCGT
TGGCACCCTGTTCTCTATCACCGTCAACCTCATTGCCGCCATTATTCTGACCCACATTATTGCCTGGAGAATTGC
CTTGGTCTGCCTGGCCCTTGTACCCCTTCTGCTTGGAGCTGGTCTAATGGAGCTCATGGTCCTCGGCAAATTCGA
GGAGCGTCATGAAAACGCTTACACCAAGTCTGTCGACATCGGTGTGGAAGCAGTTACCTCTATCAAGACAATCGC
CTCTCTTTCTCTTGAAGAGAATACTTTAAGGACCTACCGACGATCCCTGAAAGGACCCCGCAAGGAGACATTTAT
GGTCACCGTGCAGGCAAGTTTCTGGCAAGCCATGACCTACTTCCTAGGTAACATGGTAAATGCACTGGCATACTG
GTGGGGTTCCAAGCAGATCATCAACGGCAACTACAGTCAGACCCAGTTCCTGATTGTCGTCTTCTCTCTCCTAGT
CAGTGCCCTGCTTTGGAGTCAGATGTTCGCACTCGCACCTGAGCTTTCTGCCGCGCGATCGGCAATGTCCAGAAT
CCTTGGCCTGATTGAGATCGGCAAGGACAAGATGGGTGGCCGGCTCAATCCATACACCATGGATGTCGAGGCAAC
TGAAGAGAAACCCACCTACAACTCGGGCAGCACGGCTTCGAGTGTGCAGATGCGCGATGTTCACTTCTCTTACCC
TGCCCGGCCGGACATGAAGATTCTGAAGGGCTTGAACATTGATATTCGCCCCGGCAAGTTCTGTGCCCTCGTTGG
ACCCAGTGGTGCCGGTAAATCGACCATCATCTCCCTGGTTGAGCGCCTGTACAAACCCGAATCTGGCTCTATCAT
AATCGACGGAGTTGACGTGACCAAGACCTCGGATGTCACCTTCCGTGACTGGATTTCTCTTGTGCCTCAAGAGAG
CGTCCTCTTCGAAGGAAGCATTGAGTTCAATGTTGGTCTCGGTGCCCGACCCAACCACAAAGTGACCCTTGAAGA
AATTCAAGAGGCCTGTAAGCTCGCAAACATCCACGATGTTATCGCTGCATTGCCAAATGGCTACCAGACGCTCTG
TGGACCGAGTGGTAACCAGTTCTCGGGAGGCCAGAAGCAGAGATTGTCCATCGCTCGTGCTCTCGTTCGCAAGCC
CAAGCTTCTCATTCTTGATGAATCGACTAGTGCTTTGGACGCTGAATCCGAGAAGCTCTTGCAGGATGGTCTGGA
AAAGGCCGCACGGGGAATCACTGTCATCGCCATTGCTCACCGTCTTCACACTATCCGGAAGGCTGATACCATTTT
CTTGATCGATGGTGGTGTATGCACTGACTCTGGCTCTCATGAAGAATTGCTCCTGCGGTCCGACAGTTACCGGGC
GAATGTCATGCACCAGACAGTGGCGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail