Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g850.t1
Gene name
Locationscaffold_01:2265237..2266073
Strand-
Gene length (bp)836
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 2.2E-12 93 153

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 56.73 30.28 83.19
5d_25C Five days - 25 degrees Celsius 49.82 25.97 73.67
7d_25C Seven days - 25 degrees Celsius 53.66 28.32 79.00
10d_25C Ten days - 25 degrees Celsius 41.22 20.48 61.96
7d_15C Seven days - 15 degrees Celsius 45.84 23.13 68.56
7d_30C Seven days - 30 degrees Celsius 62.89 34.57 91.21

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.698122 no
3d_25C 7d_25C 0.887674 no
3d_25C 7d_15C 0.493470 no
3d_25C 7d_30C 0.760363 no
3d_25C 10d_25C 0.257081 no
5d_25C 7d_25C 0.844652 no
5d_25C 7d_15C 0.831320 no
5d_25C 7d_30C 0.424776 no
5d_25C 10d_25C 0.558622 no
7d_25C 7d_15C 0.649133 no
7d_25C 7d_30C 0.614896 no
7d_25C 10d_25C 0.380932 no
7d_15C 7d_30C 0.261341 no
7d_15C 10d_25C 0.779022 no
7d_30C 10d_25C 0.111905 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g850.t1
MTELRQRPTATSKSSNGPDKEPTSGQHSINDEASQDHGISLLDILRVIVTLLVACGGLSYYVTSSESVLWGYRPW
YTRWPVVKQWVQGPVILTPSQLSLYNGTDTSLPLYVAVNGTVFDVSENRMIYGPGGSYNFFAGRDATRAFVTGCF
KEDLTNDLRGVEIMFMPVEDVENEAVTSAQRKIRREKELRAARARVEETVKRWTGFFANHAKYFEAGRVVEDGGV
DEEPLPLCESAQQQRPKRSAMVEES*
Coding >Pro_DTO377G3_2|g850.t1
ATGACAGAACTCCGCCAGCGACCAACAGCCACGTCAAAGTCCAGCAATGGACCCGACAAAGAGCCGACCTCCGGA
CAGCACTCCATAAACGACGAAGCCAGCCAAGACCACGGCATAAGCCTGCTAGACATACTCCGCGTGATTGTGACC
CTACTCGTCGCCTGCGGTGGTCTCTCATATTATGTGACTTCCTCCGAGTCCGTGCTGTGGGGGTACAGGCCATGG
TATACACGGTGGCCGGTGGTGAAGCAGTGGGTGCAAGGCCCCGTTATCCTGACACCAAGCCAACTATCCCTCTAC
AACGGCACGGACACCAGTCTCCCCCTGTACGTCGCGGTGAACGGGACCGTCTTCGACGTCTCGGAAAATCGCATG
ATCTACGGACCCGGTGGGAGCTACAACTTCTTTGCGGGGCGGGACGCAACGCGAGCTTTTGTCACGGGCTGCTTT
AAGGAAGATCTTACGAACGACTTGCGCGGTGTCGAGATTATGTTCATGCCGGTTGAGGATGTCGAGAATGAGGCT
GTGACTTCTGCACAGAGGAAAATCCGTCGTGAGAAGGAGTTACGGGCTGCTAGAGCGCGGGTTGAGGAGACTGTC
AAGCGGTGGACTGGATTCTTTGCGAATCATGCAAAGTATTTTGAGGCTGGGAGGGTGGTTGAGGATGGAGGTGTT
GATGAAGAGCCGTTGCCGCTGTGTGAGAGCGCGCAGCAGCAGCGACCGAAGAGGAGTGCGATGGTGGAAGAGTCG
TAG
Transcript >Pro_DTO377G3_2|g850.t1
ATGACAGAACTCCGCCAGCGACCAACAGCCACGTCAAAGTCCAGCAATGGACCCGACAAAGAGCCGACCTCCGGA
CAGCACTCCATAAACGACGAAGCCAGCCAAGACCACGGCATAAGCCTGCTAGACATACTCCGCGTGATTGTGACC
CTACTCGTCGCCTGCGGTGGTCTCTCATATTATGTGACTTCCTCCGAGTCCGTGCTGTGGGGGTACAGGCCATGG
TATACACGGTGGCCGGTGGTGAAGCAGTGGGTGCAAGGCCCCGTTATCCTGACACCAAGCCAACTATCCCTCTAC
AACGGCACGGACACCAGTCTCCCCCTGTACGTCGCGGTGAACGGGACCGTCTTCGACGTCTCGGAAAATCGCATG
ATCTACGGACCCGGTGGGAGCTACAACTTCTTTGCGGGGCGGGACGCAACGCGAGCTTTTGTCACGGGCTGCTTT
AAGGAAGATCTTACGAACGACTTGCGCGGTGTCGAGATTATGTTCATGCCGGTTGAGGATGTCGAGAATGAGGCT
GTGACTTCTGCACAGAGGAAAATCCGTCGTGAGAAGGAGTTACGGGCTGCTAGAGCGCGGGTTGAGGAGACTGTC
AAGCGGTGGACTGGATTCTTTGCGAATCATGCAAAGTATTTTGAGGCTGGGAGGGTGGTTGAGGATGGAGGTGTT
GATGAAGAGCCGTTGCCGCTGTGTGAGAGCGCGCAGCAGCAGCGACCGAAGAGGAGTGCGATGGTGGAAGAGTCG
TAG
Gene >Pro_DTO377G3_2|g850.t1
ATGACAGAACTCCGCCAGCGACCAACAGCCACGTCAAAGTCCAGCAATGGACCCGACAAAGAGCCGACCTCCGGA
CAGCACTCCATAAACGACGAAGCCAGCCAAGACCACGGCATAAGCCTGCTAGACATACTCCGCGTGATTGTGACC
CTACTCGTCGCCTGCGGTGGTCTCTCATATTATGTGACTTCCTCCGAGTCCGTGCTGTGGGGGTACAGGCCATGG
TATACACGGTGGCCGGTGGTGAAGCAGTGGGTGGTACGCGAATCCCGGTCCTTGGTTTACAAAAAAATGAAAAGG
TCATGTTGATTCAAGCTAACACATCCATTTCTACAATAAAGCAAGGCCCCGTTATCCTGACACCAAGCCAACTAT
CCCTCTACAACGGCACGGACACCAGTCTCCCCCTGTACGTCGCGGTGAACGGGACCGTCTTCGACGTCTCGGAAA
ATCGCATGATCTACGGACCCGGTGGGAGCTACAACTTCTTTGCGGGGCGGGACGCAACGCGAGCTTTTGTCACGG
GCTGCTTTAAGGAAGATCTTACGAACGACTTGCGCGGTGTCGAGATTATGTTCATGCCGGTTGAGGATGTCGAGA
ATGAGGCTGTGACTTCTGCACAGAGGAAAATCCGTCGTGAGAAGGAGTTACGGGCTGCTAGAGCGCGGGTTGAGG
AGACTGTCAAGCGGTGGACTGGATTCTTTGCGAATCATGCAAAGTATTTTGAGGCTGGGAGGGTGGTTGAGGATG
GAGGTGTTGATGAAGAGCCGTTGCCGCTGTGTGAGAGCGCGCAGCAGCAGCGACCGAAGAGGAGTGCGATGGTGG
AAGAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail