Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8496.t1
Gene name
Locationscaffold_33:219213..225876
Strand-
Gene length (bp)6663
Transcript length (bp)6612
Coding sequence length (bp)6612
Protein length (aa) 2204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02889 Sec63 Sec63 Brl domain 4.7E-95 1029 1335
PF02889 Sec63 Sec63 Brl domain 1.7E-71 1864 2185
PF00270 DEAD DEAD/DEAH box helicase 7.7E-28 529 704
PF00270 DEAD DEAD/DEAH box helicase 3.6E-18 1380 1542
PF18149 Helicase_PWI N-terminal helicase PWI domain 1.2E-27 293 404
PF04851 ResIII Type III restriction enzyme, res subunit 1.6E-11 542 703
PF04851 ResIII Type III restriction enzyme, res subunit 2.0E-07 1374 1514
PF00271 Helicase_C Helicase conserved C-terminal domain 5.2E-07 765 907

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 39.00 23.52 54.47
5d_25C Five days - 25 degrees Celsius 41.91 25.15 58.68
7d_25C Seven days - 25 degrees Celsius 47.41 28.14 66.68
10d_25C Ten days - 25 degrees Celsius 64.48 37.55 91.41
7d_15C Seven days - 15 degrees Celsius 37.67 22.58 52.76
7d_30C Seven days - 30 degrees Celsius 43.98 26.15 61.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.820182 no
3d_25C 7d_25C 0.447391 no
3d_25C 7d_15C 0.920503 no
3d_25C 7d_30C 0.679327 no
3d_25C 10d_25C 0.019624 yes
5d_25C 7d_25C 0.660342 no
5d_25C 7d_15C 0.712393 no
5d_25C 7d_30C 0.885511 no
5d_25C 10d_25C 0.049197 yes
7d_25C 7d_15C 0.352333 no
7d_25C 7d_30C 0.812915 no
7d_25C 10d_25C 0.192358 no
7d_15C 7d_30C 0.569403 no
7d_15C 10d_25C 0.012609 yes
7d_30C 10d_25C 0.088611 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8496.t1
MADQDISQYKYSAMSNLVLQADRRFITRTHDEPTGDPESLAGRIGIREMGGRVAREDAPKSKKAAPTGLERGAIG
EGEDVLLREQKKRHRGQPAQLRGQGILSAADAFVEGLKYRPRTPATRATYDLILTITGSQLGDVPHEVVRSAADA
VLELLKDEDMKDFDKKKEIDDLLGTSMNPKEFNELVNLGKKITDYDAQDEEEEVEGGLEEEGGELDERQGVAVVF
DEDEDDERMGTVDEVRDEDELSDEEEEDEQERLAIDDAAAAQDEDGDEMVIDGGLGRSDKATEKTGLNVSAREID
AYWLQRQIGAIYTDAHIQHEKTDEALEILGGKDEDGTLKPLRDVENDLMELFDYDHPDLVAKLVTNRDKAVWVTR
WRRVAEDPSARNLVEIEMVEAGQRAILDEIRGKETGDELGAPPGKKMKFDLMDVDVPSGPTTDYKTAEGGEAGIL
QPKRTINLENLVFHQGNHLMTNANVKLPQGSTKRGFKGYEEIHVPPPKAKKEAGEKNIPTTELPEWARVGFGTSK
ELNRVQTRCYPSAFLDDGNLLVCAPTGSGKTNVAMLAILREIGKNRNPETGEIMLDDFKIVYISPLKALVQEQVG
NLGKRLEPYGIRVSELTGDRQLTKQQIADTQIIVTTPEKYDVITRKATETSYTNLVRLIVIDEIHLLHDERGPVL
ESIVSRTIRKTEQTGEPVRIVGLSATLPNYRDVGSFLRADPVKGTFHFDGSYRPCPLKQEFIGVTEKKAIKQLKT
MNDICYTKVMEQVGQQRNQMLIFVHSRKETAKTAKYIRDKALENETIGQILRSDAASRAILSEEADSVDDANLKD
LMPYGLGIHHAGLSLADRDSVQALFADGSIQVLVCTATLAWGVNLPAHTVIIKGTQVYSPEKGAWVELSPQDVLQ
MLGRAGRPQYDTFGEGIIITSQAELQYYLSLLNQQLPIESQLMSKLADNLNAEIVLGNVRTRDEGVDWLGYTYLY
VRMLRSPGLYSVGADYQNDDALEQKRVDLIHSAAVVLEKAGLVKYDKKTGRLQSTELGRISSHYYIGHNSMLTYS
QHLQPSITNIELFRIFALSDEFKYIPVRQDEKLELGKLLGRVPIPVKETIDEPHAKINVLLQAYISRLKLEGLAL
MADMVYVTQSAGRIIRAIFEICLKKGWASVAKTALDLCKMAEKRMWPTMSPLRQFPHCPRDVLQKAERIDVPWSS
YFDLDPPRMGELLSMPKAGRVVCDLVSKFPRLDVQAQVQPITRSMLRVELTITPNFVWDDEIHGNAQDFWILVED
CDGEEILFHDRFLLRAEFAKSEMNEHLVEFTVPVTDPMPPNYFISLVSDRWMHSETKIAVSFQKLVLPERFPPHT
PLLDMQRAPVKALKREDYEALYPNWQHFNKIQSQVFKSVFDTNDNIFIGAPTGSGKTVCAELALLRHWSRQDSGR
AVYIAPFQELVDHRLADWQKRLGGLDGGKTIVKLTGETTADLKLLEQADLVLATPTQWDVLSRQWQRRKNIQTVQ
LFIPDELHLLGGYAGYVYEVIVSRMHYIALQTENEMRIVGLSVPLSNARDIGEWIGANKHTIYNFSPHARPVPLE
LHLQSFTIPHFPSAMLAMARPAYQSILQLSPDKPALVFVPSRKQVRATAADLLSACAIDNDEDRFLNADASELTP
LLERVHEQTLATSLSHGIGYYHEALNATDKRIVLHLFNIGAIQVLLASRDVCWELDITAHLVIIMNTQFFDGREH
RYIDYPISDILQMFGKASRPGQDKLGRGVLMVPAVKRDYYKKFLNEALPVESHLQVYLHDAFVTEVSTRTISSTQ
DAVDWMTYTYFYRRLLANPSFYGLSDVSHEGLSTFLSELVENTLKELSEAKIIDVDEEDDSVSPLNAAMICAYYN
ISFITMQTFLLSLSSRTKLKGILEIVTSATEFESIQMRRHENHILRRVYDRVPVKMSEVSFDSPHFKAFVLLQAH
FSRMQLPLDLAKDQEDIVRKVLNLLSACVDVLSSEGHLNAMNAMELSQMVVQAMWDRDSPLKQIPHFSNEVIKVA
NEYKINDIFEFMEAMDPSENKDYATLVKRLGLDNKQLAQAAAFTNEKYPNIELDFEVEDAEGITSGEPAYLKVKI
ERDIEEDEEPDATVHAPFYPNQKMENWWLVVGDEKTKSLLAIKRVTIGRKLELRLEYVVPTPGNHELTLYLMSDS
YVGVDQAPTFSVNAAEGMDEDESEEEEE*
Coding >Pro_DTO377G3_2|g8496.t1
ATGGCGGACCAAGATATCTCACAGTATAAGTACTCGGCGATGTCCAACCTGGTTCTCCAGGCGGATCGTCGTTTT
ATCACTCGCACCCATGACGAACCCACTGGAGACCCGGAGTCTCTAGCGGGTCGCATTGGGATTCGGGAGATGGGT
GGACGAGTCGCGCGTGAAGACGCGCCCAAATCTAAAAAGGCAGCCCCGACAGGTCTTGAGCGGGGTGCAATCGGC
GAGGGTGAAGATGTGCTTCTACGCGAACAGAAAAAGCGCCACCGCGGCCAACCAGCACAACTTCGAGGCCAGGGC
ATCCTTTCAGCCGCCGATGCCTTCGTCGAAGGATTGAAATATCGTCCCCGCACACCCGCCACACGAGCCACGTAT
GACCTTATTCTCACAATCACTGGAAGCCAGCTGGGCGATGTTCCGCATGAAGTCGTTCGAAGTGCTGCCGATGCA
GTTTTGGAACTACTGAAGGACGAAGATATGAAGGATTTTGATAAAAAGAAGGAGATTGATGATCTTCTGGGTACC
TCAATGAACCCCAAGGAGTTCAACGAGCTGGTGAACCTCGGCAAAAAAATTACAGATTACGATGCCCAAGACGAA
GAGGAAGAGGTGGAAGGCGGTCTCGAGGAAGAGGGTGGCGAACTTGATGAACGCCAAGGTGTTGCCGTCGTTTTC
GATGAAGATGAAGACGATGAGCGCATGGGAACCGTAGACGAGGTTCGAGACGAGGACGAGCTCAGTGACGAAGAA
GAGGAGGATGAACAGGAACGACTCGCAATCGACGATGCTGCAGCAGCCCAAGACGAAGACGGAGATGAAATGGTC
ATCGATGGAGGTCTCGGCCGAAGTGATAAAGCCACAGAAAAGACCGGATTGAACGTCTCCGCTCGCGAAATTGAC
GCTTACTGGCTGCAACGTCAAATCGGTGCGATATACACAGATGCTCACATTCAACATGAGAAAACAGATGAAGCA
CTTGAAATCCTCGGTGGGAAGGACGAGGATGGAACATTGAAACCCCTGCGCGATGTTGAGAACGACCTCATGGAA
CTCTTCGACTATGACCATCCCGATCTTGTCGCCAAACTAGTTACCAATCGTGACAAGGCCGTCTGGGTTACTCGC
TGGAGAAGAGTCGCAGAGGATCCTTCTGCGCGCAATCTCGTGGAGATTGAGATGGTCGAAGCCGGTCAACGTGCC
ATCCTCGATGAAATCCGTGGCAAAGAAACCGGTGACGAACTTGGAGCACCACCAGGTAAGAAGATGAAGTTCGAC
TTGATGGATGTCGATGTTCCTTCGGGTCCAACTACCGATTACAAAACAGCCGAAGGTGGCGAGGCTGGCATTCTC
CAGCCCAAGAGAACAATCAATTTGGAAAATTTGGTCTTCCATCAAGGCAATCATCTTATGACCAATGCCAATGTC
AAGCTTCCCCAGGGCTCAACCAAGCGAGGATTCAAGGGGTACGAAGAGATCCATGTGCCACCACCTAAGGCTAAG
AAGGAGGCTGGAGAGAAGAATATCCCGACCACTGAGCTGCCGGAATGGGCCCGTGTTGGATTTGGAACCTCAAAA
GAACTCAACCGTGTGCAGACAAGGTGCTATCCCTCAGCTTTCCTTGACGATGGAAACCTGCTTGTTTGTGCTCCC
ACGGGTTCCGGAAAGACCAACGTTGCTATGCTCGCGATCCTTCGAGAAATCGGGAAGAATCGCAACCCTGAAACA
GGAGAGATCATGCTGGATGACTTCAAAATTGTATACATCTCTCCCTTGAAGGCTTTGGTTCAGGAACAAGTCGGC
AACCTTGGCAAGCGCTTGGAACCTTATGGTATCCGAGTGTCCGAGCTCACAGGTGATCGTCAGCTCACCAAGCAG
CAAATCGCCGATACCCAGATCATTGTCACCACCCCCGAGAAGTACGACGTCATCACCAGAAAGGCAACTGAAACT
AGCTACACCAACCTTGTCCGCCTTATTGTCATCGACGAGATTCATCTTCTCCACGATGAACGTGGCCCCGTCCTC
GAGAGCATCGTTAGCCGAACGATTCGCAAAACCGAGCAGACTGGAGAGCCTGTACGAATTGTGGGTCTCAGTGCT
ACGCTTCCCAACTACCGTGATGTGGGAAGTTTCCTGCGCGCAGATCCTGTCAAGGGCACGTTCCATTTCGACGGC
AGCTACCGTCCTTGCCCCCTCAAGCAGGAATTCATCGGTGTCACCGAAAAGAAGGCCATCAAACAGTTGAAGACG
ATGAACGACATCTGTTATACCAAGGTTATGGAGCAGGTCGGGCAACAACGAAACCAAATGCTCATCTTCGTCCAC
TCTCGAAAGGAGACTGCCAAGACCGCCAAGTACATCAGAGACAAGGCTCTTGAGAATGAAACCATTGGTCAGATT
CTGCGCAGTGACGCTGCTAGTCGTGCCATTCTCTCCGAAGAAGCAGACTCTGTGGACGATGCTAACCTGAAGGAT
CTCATGCCGTACGGTCTCGGTATTCACCATGCTGGTCTGAGTCTTGCCGATCGTGATTCCGTCCAAGCTCTTTTC
GCCGATGGAAGCATCCAAGTCCTCGTTTGTACCGCAACACTAGCCTGGGGTGTCAACCTTCCCGCCCACACCGTC
ATCATCAAGGGAACTCAGGTCTACTCCCCCGAGAAGGGTGCCTGGGTCGAGTTGAGCCCGCAAGACGTTCTGCAG
ATGTTGGGACGAGCTGGTCGACCACAATATGATACCTTCGGTGAGGGTATCATCATCACATCGCAAGCTGAACTT
CAATACTACCTCTCGCTCTTGAACCAACAGCTTCCAATTGAGTCGCAGCTGATGAGCAAACTGGCGGACAATCTC
AATGCTGAGATTGTACTTGGCAATGTCCGTACCCGCGATGAAGGTGTGGATTGGCTAGGCTACACATACCTTTAC
GTTCGGATGCTCCGATCACCTGGCCTGTACAGTGTTGGCGCCGATTATCAGAACGATGATGCACTAGAGCAAAAG
CGAGTTGATCTTATTCACTCCGCTGCTGTGGTACTTGAGAAGGCCGGTCTCGTGAAGTATGATAAGAAGACTGGG
CGTCTGCAGTCGACTGAGCTTGGACGTATCTCTTCGCACTACTATATTGGTCACAACTCAATGCTGACCTACTCC
CAACACCTCCAGCCCTCTATTACAAACATTGAATTATTCCGAATCTTTGCCTTGAGTGATGAGTTTAAATACATT
CCGGTCCGTCAGGATGAGAAGCTTGAGTTAGGAAAACTGCTCGGCCGGGTGCCCATCCCTGTCAAGGAGACGATT
GATGAACCTCATGCCAAAATCAATGTTCTTTTGCAGGCTTATATCTCTAGGCTCAAGCTTGAGGGGCTGGCCCTG
ATGGCAGACATGGTCTATGTCACTCAATCTGCTGGACGTATCATCCGCGCGATTTTCGAGATTTGCCTGAAGAAA
GGCTGGGCCTCAGTGGCCAAGACCGCGCTCGATCTGTGCAAAATGGCCGAGAAGCGCATGTGGCCAACTATGTCC
CCCCTTCGTCAATTCCCTCACTGCCCAAGGGACGTCTTGCAGAAGGCGGAGCGCATTGATGTGCCTTGGAGCAGT
TATTTCGATTTGGATCCTCCCCGTATGGGTGAGCTTCTGAGCATGCCCAAGGCTGGACGTGTTGTGTGCGACTTG
GTATCCAAGTTCCCTCGACTCGATGTTCAAGCTCAAGTGCAGCCCATCACGCGATCCATGCTGCGGGTAGAGTTG
ACCATTACCCCCAATTTTGTCTGGGATGACGAAATACATGGCAACGCTCAAGATTTCTGGATTTTGGTAGAGGAC
TGTGACGGAGAGGAGATCTTGTTCCATGATCGATTCTTGCTTCGTGCTGAATTTGCCAAGTCCGAGATGAATGAG
CATCTCGTCGAATTCACTGTTCCTGTCACTGACCCGATGCCTCCTAACTACTTCATATCGCTTGTGTCTGACCGA
TGGATGCATTCTGAGACGAAGATTGCCGTGTCCTTCCAGAAGCTGGTTCTTCCCGAGCGTTTCCCTCCCCATACG
CCTCTACTCGACATGCAGCGCGCACCCGTCAAAGCACTGAAGCGTGAGGACTACGAAGCACTGTACCCCAACTGG
CAGCATTTCAACAAGATTCAGTCTCAGGTCTTCAAGTCAGTATTCGACACCAATGACAATATCTTCATCGGTGCT
CCCACAGGAAGTGGAAAGACTGTTTGCGCTGAGTTGGCCTTGCTTCGTCACTGGTCAAGACAGGATAGCGGCCGC
GCAGTTTACATTGCGCCTTTCCAGGAGCTTGTTGATCACCGGCTAGCTGACTGGCAGAAGCGTCTTGGTGGACTG
GATGGAGGTAAAACCATTGTCAAGCTCACGGGCGAAACCACAGCCGATTTGAAACTTCTTGAACAGGCTGATCTC
GTGCTCGCCACTCCTACTCAGTGGGATGTGTTGTCGCGCCAGTGGCAGCGCCGTAAGAACATCCAGACAGTGCAA
CTGTTCATCCCCGACGAGCTACACTTGCTCGGTGGCTATGCTGGATACGTGTACGAAGTGATCGTGTCTCGCATG
CACTACATCGCTCTCCAGACTGAAAATGAAATGCGCATTGTTGGTCTTAGCGTGCCTCTCTCTAATGCTCGGGAT
ATCGGAGAGTGGATCGGTGCCAACAAGCACACCATCTACAACTTCAGCCCTCATGCCCGTCCTGTTCCTCTTGAG
CTCCACCTTCAATCTTTCACCATCCCTCACTTCCCATCCGCCATGCTTGCAATGGCTCGCCCGGCCTACCAATCG
ATTTTGCAACTCTCTCCCGATAAGCCTGCTCTGGTCTTCGTGCCAAGCCGCAAGCAGGTCCGTGCGACCGCTGCG
GATCTTCTCTCGGCGTGTGCTATCGACAACGATGAAGATCGTTTCCTGAACGCCGATGCCAGTGAGCTTACGCCT
TTGCTTGAACGTGTCCATGAGCAAACTCTTGCCACATCGCTTTCTCACGGTATTGGCTACTACCATGAAGCTCTC
AATGCCACTGACAAGCGCATTGTCTTACACCTGTTTAACATTGGTGCGATTCAGGTGCTGTTAGCTTCGAGAGAT
GTGTGCTGGGAACTGGATATCACGGCTCACTTGGTCATCATTATGAACACCCAATTCTTCGATGGTCGTGAACAT
CGCTACATCGACTACCCCATCAGCGATATCCTACAGATGTTCGGCAAAGCCTCCCGTCCCGGTCAGGACAAGCTT
GGCCGTGGTGTTCTTATGGTGCCAGCAGTGAAGCGCGACTACTACAAGAAGTTCTTGAATGAGGCCTTGCCTGTC
GAGAGTCACCTGCAGGTTTACCTCCACGATGCCTTTGTGACTGAAGTCAGCACAAGGACCATCTCCTCCACCCAG
GATGCGGTTGATTGGATGACATACACCTATTTCTATCGCCGTCTCCTTGCAAACCCCAGTTTCTACGGCCTTAGC
GATGTGAGCCACGAGGGACTCAGCACATTCCTCTCGGAACTGGTGGAGAATACATTGAAGGAGTTGTCAGAGGCA
AAGATCATCGATGTTGATGAAGAAGATGACAGCGTTTCGCCTTTGAACGCTGCTATGATCTGTGCTTACTACAAC
ATCTCTTTCATCACAATGCAAACATTCTTGTTGTCTCTCTCGTCTCGAACGAAGCTCAAGGGTATCCTGGAGATT
GTGACATCGGCGACCGAGTTTGAGTCTATCCAGATGCGTCGCCATGAGAATCACATTCTCCGTCGCGTGTATGAT
CGTGTACCGGTCAAGATGTCAGAGGTTTCCTTCGACTCTCCTCATTTCAAGGCTTTCGTCCTCCTCCAGGCCCAC
TTCTCGCGCATGCAGCTCCCTCTTGATCTTGCCAAGGACCAGGAAGACATCGTTCGCAAGGTCCTCAACCTGCTC
AGCGCTTGTGTGGATGTCCTCTCATCCGAGGGTCATCTCAACGCGATGAACGCGATGGAACTGTCCCAGATGGTG
GTTCAGGCCATGTGGGATCGTGACAGCCCTCTGAAGCAGATTCCCCACTTCTCTAATGAGGTGATCAAGGTGGCT
AATGAGTACAAAATCAATGATATCTTCGAATTCATGGAGGCCATGGATCCATCAGAGAACAAGGATTACGCTACT
TTGGTCAAGCGCCTCGGCCTTGACAACAAACAATTGGCGCAAGCTGCGGCTTTCACCAATGAGAAGTATCCCAAC
ATCGAGCTTGACTTCGAAGTTGAGGATGCCGAGGGTATCACTTCGGGCGAACCCGCATACCTCAAGGTCAAAATC
GAGCGGGACATCGAAGAAGACGAGGAGCCCGACGCTACTGTCCATGCACCATTCTACCCCAACCAGAAGATGGAG
AACTGGTGGTTGGTTGTCGGCGATGAAAAGACCAAGAGCCTGCTGGCTATCAAACGAGTCACCATCGGTCGCAAG
CTCGAGCTGCGCCTGGAATATGTAGTCCCTACACCTGGAAACCATGAGTTGACGCTCTATCTTATGAGCGACAGC
TATGTTGGTGTGGATCAGGCTCCTACGTTCAGTGTCAATGCGGCGGAGGGAATGGACGAAGATGAAAGCGAGGAA
GAGGAAGAGTAA
Transcript >Pro_DTO377G3_2|g8496.t1
ATGGCGGACCAAGATATCTCACAGTATAAGTACTCGGCGATGTCCAACCTGGTTCTCCAGGCGGATCGTCGTTTT
ATCACTCGCACCCATGACGAACCCACTGGAGACCCGGAGTCTCTAGCGGGTCGCATTGGGATTCGGGAGATGGGT
GGACGAGTCGCGCGTGAAGACGCGCCCAAATCTAAAAAGGCAGCCCCGACAGGTCTTGAGCGGGGTGCAATCGGC
GAGGGTGAAGATGTGCTTCTACGCGAACAGAAAAAGCGCCACCGCGGCCAACCAGCACAACTTCGAGGCCAGGGC
ATCCTTTCAGCCGCCGATGCCTTCGTCGAAGGATTGAAATATCGTCCCCGCACACCCGCCACACGAGCCACGTAT
GACCTTATTCTCACAATCACTGGAAGCCAGCTGGGCGATGTTCCGCATGAAGTCGTTCGAAGTGCTGCCGATGCA
GTTTTGGAACTACTGAAGGACGAAGATATGAAGGATTTTGATAAAAAGAAGGAGATTGATGATCTTCTGGGTACC
TCAATGAACCCCAAGGAGTTCAACGAGCTGGTGAACCTCGGCAAAAAAATTACAGATTACGATGCCCAAGACGAA
GAGGAAGAGGTGGAAGGCGGTCTCGAGGAAGAGGGTGGCGAACTTGATGAACGCCAAGGTGTTGCCGTCGTTTTC
GATGAAGATGAAGACGATGAGCGCATGGGAACCGTAGACGAGGTTCGAGACGAGGACGAGCTCAGTGACGAAGAA
GAGGAGGATGAACAGGAACGACTCGCAATCGACGATGCTGCAGCAGCCCAAGACGAAGACGGAGATGAAATGGTC
ATCGATGGAGGTCTCGGCCGAAGTGATAAAGCCACAGAAAAGACCGGATTGAACGTCTCCGCTCGCGAAATTGAC
GCTTACTGGCTGCAACGTCAAATCGGTGCGATATACACAGATGCTCACATTCAACATGAGAAAACAGATGAAGCA
CTTGAAATCCTCGGTGGGAAGGACGAGGATGGAACATTGAAACCCCTGCGCGATGTTGAGAACGACCTCATGGAA
CTCTTCGACTATGACCATCCCGATCTTGTCGCCAAACTAGTTACCAATCGTGACAAGGCCGTCTGGGTTACTCGC
TGGAGAAGAGTCGCAGAGGATCCTTCTGCGCGCAATCTCGTGGAGATTGAGATGGTCGAAGCCGGTCAACGTGCC
ATCCTCGATGAAATCCGTGGCAAAGAAACCGGTGACGAACTTGGAGCACCACCAGGTAAGAAGATGAAGTTCGAC
TTGATGGATGTCGATGTTCCTTCGGGTCCAACTACCGATTACAAAACAGCCGAAGGTGGCGAGGCTGGCATTCTC
CAGCCCAAGAGAACAATCAATTTGGAAAATTTGGTCTTCCATCAAGGCAATCATCTTATGACCAATGCCAATGTC
AAGCTTCCCCAGGGCTCAACCAAGCGAGGATTCAAGGGGTACGAAGAGATCCATGTGCCACCACCTAAGGCTAAG
AAGGAGGCTGGAGAGAAGAATATCCCGACCACTGAGCTGCCGGAATGGGCCCGTGTTGGATTTGGAACCTCAAAA
GAACTCAACCGTGTGCAGACAAGGTGCTATCCCTCAGCTTTCCTTGACGATGGAAACCTGCTTGTTTGTGCTCCC
ACGGGTTCCGGAAAGACCAACGTTGCTATGCTCGCGATCCTTCGAGAAATCGGGAAGAATCGCAACCCTGAAACA
GGAGAGATCATGCTGGATGACTTCAAAATTGTATACATCTCTCCCTTGAAGGCTTTGGTTCAGGAACAAGTCGGC
AACCTTGGCAAGCGCTTGGAACCTTATGGTATCCGAGTGTCCGAGCTCACAGGTGATCGTCAGCTCACCAAGCAG
CAAATCGCCGATACCCAGATCATTGTCACCACCCCCGAGAAGTACGACGTCATCACCAGAAAGGCAACTGAAACT
AGCTACACCAACCTTGTCCGCCTTATTGTCATCGACGAGATTCATCTTCTCCACGATGAACGTGGCCCCGTCCTC
GAGAGCATCGTTAGCCGAACGATTCGCAAAACCGAGCAGACTGGAGAGCCTGTACGAATTGTGGGTCTCAGTGCT
ACGCTTCCCAACTACCGTGATGTGGGAAGTTTCCTGCGCGCAGATCCTGTCAAGGGCACGTTCCATTTCGACGGC
AGCTACCGTCCTTGCCCCCTCAAGCAGGAATTCATCGGTGTCACCGAAAAGAAGGCCATCAAACAGTTGAAGACG
ATGAACGACATCTGTTATACCAAGGTTATGGAGCAGGTCGGGCAACAACGAAACCAAATGCTCATCTTCGTCCAC
TCTCGAAAGGAGACTGCCAAGACCGCCAAGTACATCAGAGACAAGGCTCTTGAGAATGAAACCATTGGTCAGATT
CTGCGCAGTGACGCTGCTAGTCGTGCCATTCTCTCCGAAGAAGCAGACTCTGTGGACGATGCTAACCTGAAGGAT
CTCATGCCGTACGGTCTCGGTATTCACCATGCTGGTCTGAGTCTTGCCGATCGTGATTCCGTCCAAGCTCTTTTC
GCCGATGGAAGCATCCAAGTCCTCGTTTGTACCGCAACACTAGCCTGGGGTGTCAACCTTCCCGCCCACACCGTC
ATCATCAAGGGAACTCAGGTCTACTCCCCCGAGAAGGGTGCCTGGGTCGAGTTGAGCCCGCAAGACGTTCTGCAG
ATGTTGGGACGAGCTGGTCGACCACAATATGATACCTTCGGTGAGGGTATCATCATCACATCGCAAGCTGAACTT
CAATACTACCTCTCGCTCTTGAACCAACAGCTTCCAATTGAGTCGCAGCTGATGAGCAAACTGGCGGACAATCTC
AATGCTGAGATTGTACTTGGCAATGTCCGTACCCGCGATGAAGGTGTGGATTGGCTAGGCTACACATACCTTTAC
GTTCGGATGCTCCGATCACCTGGCCTGTACAGTGTTGGCGCCGATTATCAGAACGATGATGCACTAGAGCAAAAG
CGAGTTGATCTTATTCACTCCGCTGCTGTGGTACTTGAGAAGGCCGGTCTCGTGAAGTATGATAAGAAGACTGGG
CGTCTGCAGTCGACTGAGCTTGGACGTATCTCTTCGCACTACTATATTGGTCACAACTCAATGCTGACCTACTCC
CAACACCTCCAGCCCTCTATTACAAACATTGAATTATTCCGAATCTTTGCCTTGAGTGATGAGTTTAAATACATT
CCGGTCCGTCAGGATGAGAAGCTTGAGTTAGGAAAACTGCTCGGCCGGGTGCCCATCCCTGTCAAGGAGACGATT
GATGAACCTCATGCCAAAATCAATGTTCTTTTGCAGGCTTATATCTCTAGGCTCAAGCTTGAGGGGCTGGCCCTG
ATGGCAGACATGGTCTATGTCACTCAATCTGCTGGACGTATCATCCGCGCGATTTTCGAGATTTGCCTGAAGAAA
GGCTGGGCCTCAGTGGCCAAGACCGCGCTCGATCTGTGCAAAATGGCCGAGAAGCGCATGTGGCCAACTATGTCC
CCCCTTCGTCAATTCCCTCACTGCCCAAGGGACGTCTTGCAGAAGGCGGAGCGCATTGATGTGCCTTGGAGCAGT
TATTTCGATTTGGATCCTCCCCGTATGGGTGAGCTTCTGAGCATGCCCAAGGCTGGACGTGTTGTGTGCGACTTG
GTATCCAAGTTCCCTCGACTCGATGTTCAAGCTCAAGTGCAGCCCATCACGCGATCCATGCTGCGGGTAGAGTTG
ACCATTACCCCCAATTTTGTCTGGGATGACGAAATACATGGCAACGCTCAAGATTTCTGGATTTTGGTAGAGGAC
TGTGACGGAGAGGAGATCTTGTTCCATGATCGATTCTTGCTTCGTGCTGAATTTGCCAAGTCCGAGATGAATGAG
CATCTCGTCGAATTCACTGTTCCTGTCACTGACCCGATGCCTCCTAACTACTTCATATCGCTTGTGTCTGACCGA
TGGATGCATTCTGAGACGAAGATTGCCGTGTCCTTCCAGAAGCTGGTTCTTCCCGAGCGTTTCCCTCCCCATACG
CCTCTACTCGACATGCAGCGCGCACCCGTCAAAGCACTGAAGCGTGAGGACTACGAAGCACTGTACCCCAACTGG
CAGCATTTCAACAAGATTCAGTCTCAGGTCTTCAAGTCAGTATTCGACACCAATGACAATATCTTCATCGGTGCT
CCCACAGGAAGTGGAAAGACTGTTTGCGCTGAGTTGGCCTTGCTTCGTCACTGGTCAAGACAGGATAGCGGCCGC
GCAGTTTACATTGCGCCTTTCCAGGAGCTTGTTGATCACCGGCTAGCTGACTGGCAGAAGCGTCTTGGTGGACTG
GATGGAGGTAAAACCATTGTCAAGCTCACGGGCGAAACCACAGCCGATTTGAAACTTCTTGAACAGGCTGATCTC
GTGCTCGCCACTCCTACTCAGTGGGATGTGTTGTCGCGCCAGTGGCAGCGCCGTAAGAACATCCAGACAGTGCAA
CTGTTCATCCCCGACGAGCTACACTTGCTCGGTGGCTATGCTGGATACGTGTACGAAGTGATCGTGTCTCGCATG
CACTACATCGCTCTCCAGACTGAAAATGAAATGCGCATTGTTGGTCTTAGCGTGCCTCTCTCTAATGCTCGGGAT
ATCGGAGAGTGGATCGGTGCCAACAAGCACACCATCTACAACTTCAGCCCTCATGCCCGTCCTGTTCCTCTTGAG
CTCCACCTTCAATCTTTCACCATCCCTCACTTCCCATCCGCCATGCTTGCAATGGCTCGCCCGGCCTACCAATCG
ATTTTGCAACTCTCTCCCGATAAGCCTGCTCTGGTCTTCGTGCCAAGCCGCAAGCAGGTCCGTGCGACCGCTGCG
GATCTTCTCTCGGCGTGTGCTATCGACAACGATGAAGATCGTTTCCTGAACGCCGATGCCAGTGAGCTTACGCCT
TTGCTTGAACGTGTCCATGAGCAAACTCTTGCCACATCGCTTTCTCACGGTATTGGCTACTACCATGAAGCTCTC
AATGCCACTGACAAGCGCATTGTCTTACACCTGTTTAACATTGGTGCGATTCAGGTGCTGTTAGCTTCGAGAGAT
GTGTGCTGGGAACTGGATATCACGGCTCACTTGGTCATCATTATGAACACCCAATTCTTCGATGGTCGTGAACAT
CGCTACATCGACTACCCCATCAGCGATATCCTACAGATGTTCGGCAAAGCCTCCCGTCCCGGTCAGGACAAGCTT
GGCCGTGGTGTTCTTATGGTGCCAGCAGTGAAGCGCGACTACTACAAGAAGTTCTTGAATGAGGCCTTGCCTGTC
GAGAGTCACCTGCAGGTTTACCTCCACGATGCCTTTGTGACTGAAGTCAGCACAAGGACCATCTCCTCCACCCAG
GATGCGGTTGATTGGATGACATACACCTATTTCTATCGCCGTCTCCTTGCAAACCCCAGTTTCTACGGCCTTAGC
GATGTGAGCCACGAGGGACTCAGCACATTCCTCTCGGAACTGGTGGAGAATACATTGAAGGAGTTGTCAGAGGCA
AAGATCATCGATGTTGATGAAGAAGATGACAGCGTTTCGCCTTTGAACGCTGCTATGATCTGTGCTTACTACAAC
ATCTCTTTCATCACAATGCAAACATTCTTGTTGTCTCTCTCGTCTCGAACGAAGCTCAAGGGTATCCTGGAGATT
GTGACATCGGCGACCGAGTTTGAGTCTATCCAGATGCGTCGCCATGAGAATCACATTCTCCGTCGCGTGTATGAT
CGTGTACCGGTCAAGATGTCAGAGGTTTCCTTCGACTCTCCTCATTTCAAGGCTTTCGTCCTCCTCCAGGCCCAC
TTCTCGCGCATGCAGCTCCCTCTTGATCTTGCCAAGGACCAGGAAGACATCGTTCGCAAGGTCCTCAACCTGCTC
AGCGCTTGTGTGGATGTCCTCTCATCCGAGGGTCATCTCAACGCGATGAACGCGATGGAACTGTCCCAGATGGTG
GTTCAGGCCATGTGGGATCGTGACAGCCCTCTGAAGCAGATTCCCCACTTCTCTAATGAGGTGATCAAGGTGGCT
AATGAGTACAAAATCAATGATATCTTCGAATTCATGGAGGCCATGGATCCATCAGAGAACAAGGATTACGCTACT
TTGGTCAAGCGCCTCGGCCTTGACAACAAACAATTGGCGCAAGCTGCGGCTTTCACCAATGAGAAGTATCCCAAC
ATCGAGCTTGACTTCGAAGTTGAGGATGCCGAGGGTATCACTTCGGGCGAACCCGCATACCTCAAGGTCAAAATC
GAGCGGGACATCGAAGAAGACGAGGAGCCCGACGCTACTGTCCATGCACCATTCTACCCCAACCAGAAGATGGAG
AACTGGTGGTTGGTTGTCGGCGATGAAAAGACCAAGAGCCTGCTGGCTATCAAACGAGTCACCATCGGTCGCAAG
CTCGAGCTGCGCCTGGAATATGTAGTCCCTACACCTGGAAACCATGAGTTGACGCTCTATCTTATGAGCGACAGC
TATGTTGGTGTGGATCAGGCTCCTACGTTCAGTGTCAATGCGGCGGAGGGAATGGACGAAGATGAAAGCGAGGAA
GAGGAAGAGTAA
Gene >Pro_DTO377G3_2|g8496.t1
ATGGCGGACCAAGATATCTCACAGTATAAGTACTCGGCGATGTCCAACCTGGTTCTCCAGGCGGATCGTCGTTTT
ATCACTCGCACCCATGACGAACCCACTGGAGACCCGGAGTCTCTAGCGGGTCGCATTGGGATTCGGGAGATGGGT
GGACGAGTCGCGCGTGAAGACGCGCCCAAATCTAAAAAGGCAGCCCCGACAGGTCTTGAGCGGGGTGCAATCGGC
GAGGGTGAAGATGTGCTTCTACGCGAACAGAAAAAGCGCCACCGCGGCCAACCAGCACAACTTCGAGGCCAGGGC
ATCCTTTCAGCCGCCGATGCCTTCGTCGAAGGATTGAAATATCGTCCCCGCACACCCGCCACACGAGCCACGTAT
GACCTTATTCTCACAATCACTGGAAGCCAGCTGGGCGATGTTCCGCATGAAGTCGTTCGAAGTGCTGCCGATGCA
GTTTTGGAACTACTGAAGGACGAAGATATGAAGGATTTTGATAAAAAGAAGGAGATTGATGATCTTCTGGGTACC
TCAATGAACCCCAAGGAGTTCAACGAGCTGGTGAACCTCGGCAAAAAAATTACAGATTACGATGCCCAAGACGAA
GAGGAAGAGGTGGAAGGCGGTCTCGAGGAAGAGGGTGGCGAACTTGATGAACGCCAAGGTGTTGCCGTCGTTTTC
GATGAAGATGAAGACGATGAGCGCATGGGAACCGTAGACGAGGTTCGAGACGAGGACGAGCTCAGTGACGAAGAA
GAGGAGGATGAACAGGAACGACTCGCAATCGACGATGCTGCAGCAGCCCAAGACGAAGACGGAGATGAAATGGTC
ATCGATGGAGGTCTCGGCCGAAGTGATAAAGCCACAGAAAAGACCGGATTGAACGTCTCCGCTCGCGAAATTGAC
GCTTACTGGCTGCAACGTCAAATCGGTGCGATATACACAGATGCTCACATTCAACATGAGAAAACAGATGAAGCA
CTTGAAATCCTCGGTGGGAAGGACGAGGATGGAACATTGAAACCCCTGCGCGATGTTGAGAACGACCTCATGGAA
CTCTTCGACTATGACCATCCCGATCTTGTCGCCAAACTAGTTACCAATCGTGACAAGGCCGTCTGGGTTACTCGC
TGGAGAAGAGTCGCAGAGGATCCTTCTGCGCGCAATCTCGTGGAGATTGAGATGGTCGAAGCCGGTCAACGTGCC
ATCCTCGATGAAATCCGTGGCAAAGAAACCGGTGACGAACTTGGAGCACCACCAGGTAAGAAGATGAAGTTCGAC
TTGATGGATGTCGATGTTCCTTCGGGTCCAACTACCGATTACAAAACAGCCGAAGGTGGCGAGGCTGGCATTCTC
CAGCCCAAGAGAACAATCAATTTGGAAAATTTGGTCTTCCATCAAGGCAATCATCTTATGACCAATGCCAATGTC
AAGCTTCCCCAGGGCTCAACCAAGCGAGGATTCAAGGGGTACGAAGAGATCCATGTGCCACCACCTAAGGCTAAG
AAGGAGGCTGGAGAGAAGAATATCCCGACCACTGAGCTGCCGGAATGGGCCCGTGTTGGATTTGGAACCTCAAAA
GAACTCAACCGTGTGCAGACAAGGTGCTATCCCTCAGCTTTCCTTGACGATGGAAACCTGCTTGTTTGTGCTCCC
ACGGGTTCCGGAAAGACCAACGTTGCTATGCTCGCGATCCTTCGAGAAATCGGGAAGAATCGCAACCCTGAAACA
GGAGAGATCATGCTGGATGACTTCAAAATTGTATACATCTCTCCCTTGAAGGCTTTGGTTCAGGAACAAGTCGGC
AACCTTGGCAAGCGCTTGGAACCTTATGGTATCCGAGTGTCCGAGCTCACAGGTGATCGTCAGCTCACCAAGCAG
CAAATCGCCGATACCCAGATCATTGTCACCACCCCCGAGAAGTACGACGTCATCACCAGAAAGGCAACTGAAACT
AGCTACACCAACCTTGTCCGCCTTATTGTCATCGACGAGATTCATCTTCTCCACGATGAACGTGGCCCCGTCCTC
GAGAGCATCGTTAGCCGAACGATTCGCAAAACCGAGCAGACTGGAGAGCCTGTACGAATTGTGGGTCTCAGTGCT
ACGCTTCCCAACTACCGTGATGTGGGAAGTTTCCTGCGCGCAGATCCTGTCAAGGGCACGTTCCATTTCGACGGC
AGCTACCGTCCTTGCCCCCTCAAGCAGGAATTCATCGGTGTCACCGAAAAGAAGGCCATCAAACAGTTGAAGACG
ATGAACGACATCTGTTATACCAAGGTTATGGAGCAGGTCGGGCAACAACGAAACCAAATGCTCATCTTCGTCCAC
TCTCGAAAGGAGACTGCCAAGACCGCCAAGTACATCAGAGACAAGGCTCTTGAGAATGAAACCATTGGTCAGATT
CTGCGCAGTGACGCTGCTAGTCGTGCCATTCTCTCCGAAGAAGCAGACTCTGTGGACGATGCTAACCTGAAGGAT
CTCATGCCGTACGGTCTCGGTATTCACCATGCTGGTCTGAGTCTTGCCGATCGTGATTCCGTCCAAGCTCTTTTC
GCCGATGGAAGCATCCAAGTCCTCGTTTGTACCGCAACACTAGCCTGGGGTGTCAACCTTCCCGCCCACACCGTC
ATCATCAAGGGAACTCAGGTCTACTCCCCCGAGAAGGGTGCCTGGGTCGAGTTGAGCCCGCAAGACGTTCTGCAG
ATGTTGGGACGAGCTGGTCGACCACAATATGATACCTTCGGTGAGGGTATCATCATCACATCGCAAGCTGAACTT
CAATACTACCTCTCGCTCTTGAACCAACAGCTTCCAATTGAGTCGCAGCTGATGAGCAAACTGGCGGACAATCTC
AATGCTGAGATTGTACTTGGCAATGTCCGTACCCGCGATGAAGGTGTGGATTGGCTAGGCTACACATACCTTTAC
GTTCGGATGCTCCGATCACCTGGCCTGTACAGTGTTGGCGCCGATTATCAGAACGATGATGCACTAGAGCAAAAG
CGAGTTGATCTTATTCACTCCGCTGCTGTGGTACTTGAGAAGGCCGGTCTCGTGAAGTATGATAAGAAGACTGGG
CGTCTGCAGTCGACTGAGCTTGGACGTATCTCTTCGCACTACTATATTGGTCACAACTCAATGCTGACCTACTCC
CAACACCTCCAGCCCTCTATTACAAACATTGAATTATTCCGAATCTTTGCCTTGAGTGATGAGTTTAAATACATT
CCGGTCCGTCAGGATGAGAAGCTTGAGTTAGGAAAACTGCTCGGCCGGGTGCCCATCCCTGTCAAGGAGACGATT
GATGAACCTCATGCCAAAATCAATGTTCTTTTGCAGGCTTATATCTCTAGGCTCAAGCTTGAGGGGCTGGCCCTG
ATGGCAGACATGGTCTATGTCACTCAATCTGCTGGACGTATCATCCGCGCGATTTTCGAGATTTGCCTGAAGAAA
GGCTGGGCCTCAGTGGCCAAGACCGCGCTCGATCTGTGCAAAATGGCCGAGAAGCGCATGTGGCCAACTATGTCC
CCCCTTCGTCAATTCCCTCACTGCCCAAGGGACGTCTTGCAGAAGGCGGAGCGCATTGATGTGCCTTGGAGCAGT
TATTTCGATTTGGATCCTCCCCGTATGGGTGAGCTTCTGAGCATGCCCAAGGCTGGACGTGTTGTGTGCGACTTG
GTATCCAAGTTCCCTCGACTCGATGTTCAAGCTCAAGTGCAGCCCATCACGCGATCCATGCTGCGGGTAGAGTTG
ACCATTACCCCCAATTTTGTCTGGGATGACGAAATACATGGCAACGCTCAAGATTTCTGGATTTTGGTAGAGGAC
TGTGACGGAGAGGAGATCTTGTTCCATGATCGATTCTTGCTTCGTGCTGAATTTGCCAAGTCCGAGATGAATGAG
CATCTCGTCGAATTCACTGTTCCTGTCACTGACCCGATGCCTCCTAACTACTTCATATCGCTTGTGTCTGACCGA
TGGATGCATTCTGAGACGAAGATTGCCGTGTCCTTCCAGAAGCTGGTTCTTCCCGAGCGTTTCCCTCCCCATACG
CCTCTACTCGACATGCAGCGCGCACCCGTCAAAGCACTGAAGCGTGAGGACTACGAAGCACTGTACCCCAACTGG
CAGCATTTCAACAAGATTCAGTCTCAGGTCTTCAAGTCAGTATTCGACACCAATGACAATATCTTCATCGGTGCT
CCCACAGGAAGTGGAAAGACTGTTTGCGCTGAGTTGGCCTTGCTTCGTCACTGGTCAAGACAGGATAGCGGCCGC
GCAGTTTACATTGCGCCTTTCCAGGAGCTTGTTGATCACCGGCTAGCTGACTGGCAGAAGCGTCTTGGTGGACTG
GATGGAGGTAAAACCATTGTCAAGCTCACGGGCGAAACCACAGCCGATTTGAAACTTCTTGAACAGGCTGATCTC
GTGCTCGCCACTCCTACTCAGTGGGATGTGTTGTCGCGCCAGTGGCAGCGCCGTAAGAACATCCAGACAGTGCAA
CTGTTCATCCCCGACGAGCTACACTTGCTCGGTGGCTATGCTGGATACGTGTACGAAGTGATCGTGTCTCGCATG
CACTACATCGCTCTCCAGACTGAAAATGAAATGCGCATTGTTGGTCTTAGCGTGCCTCTCTCTAATGCTCGGGAT
ATCGGAGAGTGGATCGGTGCCAACAAGCACACCATCTACAACTTCAGCCCTCATGCCCGTCCTGTTCCTCTTGAG
CTCCACCTTCAATCTTTCACCATCCCTCACTTCCCATCCGCCATGCTTGCAATGGCTCGCCCGGCCTACCAATCG
ATTTTGCAACTCTCTCCCGATAAGCCTGCTCTGGTCTTCGTGCCAAGCCGCAAGCAGGTCCGTGCGACCGCTGCG
GATCTTCTCTCGGCGTGTGCTATCGACAACGATGAAGATCGTTTCCTGAACGCCGATGCCAGTGAGCTTACGCCT
TTGCTTGAACGTGTCCATGAGCAAACTCTTGCCACATCGCTTTCTCACGGTATTGGCTACTACCATGAAGCTCTC
AATGCCACTGACAAGCGCATTGTCTTACACCTGTTTAACATTGGTGCGATTCAGGTGCTGTTAGCTTCGAGAGAT
GTGTGCTGGGAACTGGATATCACGGCTCACTTGGTCATCATTATGAACACCCAATTCTTCGATGGTCGTGAACAT
CGCTACATCGACTACCCCATCAGCGATATCCTACAGATGTTCGGCAAAGCCTCCCGTCCCGGTCAGGACAAGCTT
GGCCGTGGTGTTCTTATGGTGCCAGCAGTGAAGCGCGACTACTACAAGAAGTTCTTGAATGAGGCCTTGCCTGTC
GAGAGTCACCTGCAGGTTTACCTCCACGATGCCTTTGTGACTGAAGTCAGCACAAGGACCATCTCCTCCACCCAG
GATGCGGTTGATTGGATGACATACACCTATTTCTATCGCCGTCTCCTTGCAAACCCCAGTTTCTACGGCCTTAGC
GATGTGAGCCACGAGGGACTCAGCACATTCCTCTCGGAACTGGTGGAGAATACATTGAAGGAGTTGTCAGAGGCA
AAGATCATCGATGTTGATGAAGAAGATGACAGCGTTTCGCCTTTGAACGCTGCTATGATCTGTGCTTACTACAAC
ATCTCTTTCATCACAATGCAAACATTCTTGTTGTCTCTCTCGTCTCGAACGAAGCTCAAGGGTATCCTGGAGATT
GTGACATCGGCGACCGAGTTTGAGTCTATCCAGATGCGTCGCCATGAGAATCACATTCTCCGTCGCGTGTATGAT
CGTGTACCGGTCAAGATGTCAGAGGTTTCCTTCGACTCTCCTCATTTCAAGGCTTTCGTCCTCCTCCAGGCCCAC
TTCTCGCGCATGCAGCTCCCTCTTGATCTTGCCAAGGACCAGGAAGACATCGTTCGCAAGGTCCTCAACCTGCTC
AGCGCTTGTGTGGATGTCCTCTCATCCGAGGGTCATCTCAACGCGATGAACGCGATGGAACTGTCCCAGATGGTG
GTTCAGGCCATGTGGGATCGTGACAGCCCTCTGAAGCAGATTCCCCACTTCTCTAATGAGGTGATCAAGGTGGCT
AATGAGTACAAGTATGTATCGTTCGAAATATCTCTAGACACATTTGCTGACCCTTTGTACAGAATCAATGATATC
TTCGAATTCATGGAGGCCATGGATCCATCAGAGAACAAGGATTACGCTACTTTGGTCAAGCGCCTCGGCCTTGAC
AACAAACAATTGGCGCAAGCTGCGGCTTTCACCAATGAGAAGTATCCCAACATCGAGCTTGACTTCGAAGTTGAG
GATGCCGAGGGTATCACTTCGGGCGAACCCGCATACCTCAAGGTCAAAATCGAGCGGGACATCGAAGAAGACGAG
GAGCCCGACGCTACTGTCCATGCACCATTCTACCCCAACCAGAAGATGGAGAACTGGTGGTTGGTTGTCGGCGAT
GAAAAGACCAAGAGCCTGCTGGCTATCAAACGAGTCACCATCGGTCGCAAGCTCGAGCTGCGCCTGGAATATGTA
GTCCCTACACCTGGAAACCATGAGTTGACGCTCTATCTTATGAGCGACAGCTATGTTGGTGTGGATCAGGCTCCT
ACGTTCAGTGTCAATGCGGCGGAGGGAATGGACGAAGATGAAAGCGAGGAAGAGGAAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail