Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8486.t1
Gene name
Locationscaffold_33:200412..201651
Strand+
Gene length (bp)1239
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03595 SLAC1 Voltage-dependent anion channel 4.8E-84 56 391

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 58 77 19
2 90 112 22
3 127 149 22
4 162 184 22
5 194 216 22
6 223 245 22
7 265 287 22
8 308 333 25
9 343 365 22
10 372 394 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 5.85 1.81 9.89
5d_25C Five days - 25 degrees Celsius 9.12 3.42 14.83
7d_25C Seven days - 25 degrees Celsius 12.15 4.98 19.33
10d_25C Ten days - 25 degrees Celsius 22.56 10.96 34.16
7d_15C Seven days - 15 degrees Celsius 7.49 2.59 12.39
7d_30C Seven days - 30 degrees Celsius 11.65 4.73 18.57

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.256929 no
3d_25C 7d_25C 0.034125 yes
3d_25C 7d_15C 0.579359 no
3d_25C 7d_30C 0.047323 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.465505 no
5d_25C 7d_15C 0.660402 no
5d_25C 7d_30C 0.562341 no
5d_25C 10d_25C 0.003625 yes
7d_25C 7d_15C 0.164015 no
7d_25C 7d_30C 0.935439 no
7d_25C 10d_25C 0.034793 yes
7d_15C 7d_30C 0.222448 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.030863 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8486.t1
MSNPVLLGVYPNHSQELQPPSAPPSAPPSAHSETPFMESEKYQKQYPLSFRDRLRHFTWAWYTLTMSAGGLALLI
ANQPNKFTGYHEIGLAIYLINLVLFSLVCSLMAARFIIHGGALNSLRHEREGLFFPTFWLSAATLITGLEKYFGE
NPAPSFTATLEVLFWIYCFCTFTLAVVQYSFVFTSHTYRLQTMMPSWILPAFPIMLSGTIASVIAKSQPARAAIP
IVTAGMTFQGLGFCISFMMYSHYIGRLMESGLPCREHRPAMFICVGPPAFTALALVGMAQGLPATFNVMGSEDTT
ADGRMLEILALAAGAFLWALSFWFFCVAAIAVIRAPPTSFHLSWWAMVFPNTGFTIATITLGNAFDSSAIKGVGS
AMTICIVCMFLFVFVNHGLAVYRQDIMYPGKDEDTSD*
Coding >Pro_DTO377G3_2|g8486.t1
ATGTCCAACCCAGTTCTACTAGGGGTCTACCCTAACCACAGCCAAGAGCTTCAGCCTCCATCTGCACCGCCGTCT
GCACCGCCGTCTGCTCACTCCGAAACACCCTTCATGGAATCAGAGAAGTACCAGAAGCAGTACCCACTGAGCTTC
CGCGATCGTCTCCGCCATTTCACATGGGCATGGTACACCCTCACCATGAGCGCAGGAGGCCTCGCCCTTCTTATA
GCGAACCAGCCGAACAAGTTCACAGGCTACCACGAGATCGGCCTAGCCATCTATCTGATCAACCTCGTCCTCTTC
TCCCTCGTCTGCTCTCTCATGGCAGCGCGATTCATAATCCACGGCGGCGCCCTCAACTCCCTCCGCCACGAACGC
GAGGGCCTCTTCTTCCCAACCTTCTGGCTCTCCGCCGCAACACTGATCACCGGCCTGGAGAAGTACTTCGGCGAG
AACCCCGCCCCATCCTTCACAGCCACACTCGAAGTCCTCTTCTGGATATACTGCTTCTGCACATTCACTCTCGCC
GTTGTACAATACTCCTTCGTCTTCACCTCGCACACCTACCGCCTGCAAACAATGATGCCCTCGTGGATCCTCCCC
GCGTTCCCAATTATGCTAAGCGGGACGATCGCGTCTGTAATCGCCAAAAGCCAGCCCGCGCGCGCAGCAATCCCA
ATCGTCACTGCCGGAATGACCTTCCAAGGTCTAGGCTTCTGCATCTCCTTCATGATGTACTCGCACTACATCGGC
CGGCTGATGGAGAGCGGACTTCCATGTCGGGAACACAGACCGGCGATGTTCATCTGCGTTGGACCACCAGCGTTC
ACCGCGCTTGCTCTCGTGGGTATGGCGCAGGGACTGCCTGCGACGTTCAACGTGATGGGCAGTGAGGACACTACT
GCCGACGGGCGGATGCTGGAGATTCTGGCGTTGGCGGCAGGCGCGTTCTTGTGGGCGCTGAGCTTTTGGTTCTTC
TGTGTCGCTGCTATTGCGGTTATTCGGGCGCCGCCGACGAGCTTCCATCTCAGCTGGTGGGCGATGGTTTTCCCG
AATACTGGGTTTACGATTGCGACCATTACGCTTGGAAATGCGTTTGACAGCTCCGCGATTAAGGGCGTTGGCTCT
GCGATGACTATCTGCATCGTCTGCATGTTCCTCTTCGTCTTTGTCAACCATGGTCTTGCAGTCTATCGCCAGGAT
ATTATGTATCCTGGTAAAGATGAGGATACCTCGGATTGA
Transcript >Pro_DTO377G3_2|g8486.t1
ATGTCCAACCCAGTTCTACTAGGGGTCTACCCTAACCACAGCCAAGAGCTTCAGCCTCCATCTGCACCGCCGTCT
GCACCGCCGTCTGCTCACTCCGAAACACCCTTCATGGAATCAGAGAAGTACCAGAAGCAGTACCCACTGAGCTTC
CGCGATCGTCTCCGCCATTTCACATGGGCATGGTACACCCTCACCATGAGCGCAGGAGGCCTCGCCCTTCTTATA
GCGAACCAGCCGAACAAGTTCACAGGCTACCACGAGATCGGCCTAGCCATCTATCTGATCAACCTCGTCCTCTTC
TCCCTCGTCTGCTCTCTCATGGCAGCGCGATTCATAATCCACGGCGGCGCCCTCAACTCCCTCCGCCACGAACGC
GAGGGCCTCTTCTTCCCAACCTTCTGGCTCTCCGCCGCAACACTGATCACCGGCCTGGAGAAGTACTTCGGCGAG
AACCCCGCCCCATCCTTCACAGCCACACTCGAAGTCCTCTTCTGGATATACTGCTTCTGCACATTCACTCTCGCC
GTTGTACAATACTCCTTCGTCTTCACCTCGCACACCTACCGCCTGCAAACAATGATGCCCTCGTGGATCCTCCCC
GCGTTCCCAATTATGCTAAGCGGGACGATCGCGTCTGTAATCGCCAAAAGCCAGCCCGCGCGCGCAGCAATCCCA
ATCGTCACTGCCGGAATGACCTTCCAAGGTCTAGGCTTCTGCATCTCCTTCATGATGTACTCGCACTACATCGGC
CGGCTGATGGAGAGCGGACTTCCATGTCGGGAACACAGACCGGCGATGTTCATCTGCGTTGGACCACCAGCGTTC
ACCGCGCTTGCTCTCGTGGGTATGGCGCAGGGACTGCCTGCGACGTTCAACGTGATGGGCAGTGAGGACACTACT
GCCGACGGGCGGATGCTGGAGATTCTGGCGTTGGCGGCAGGCGCGTTCTTGTGGGCGCTGAGCTTTTGGTTCTTC
TGTGTCGCTGCTATTGCGGTTATTCGGGCGCCGCCGACGAGCTTCCATCTCAGCTGGTGGGCGATGGTTTTCCCG
AATACTGGGTTTACGATTGCGACCATTACGCTTGGAAATGCGTTTGACAGCTCCGCGATTAAGGGCGTTGGCTCT
GCGATGACTATCTGCATCGTCTGCATGTTCCTCTTCGTCTTTGTCAACCATGGTCTTGCAGTCTATCGCCAGGAT
ATTATGTATCCTGGTAAAGATGAGGATACCTCGGATTGA
Gene >Pro_DTO377G3_2|g8486.t1
ATGTCCAACCCAGTTCTACTAGGGGTCTACCCTAACCACAGCCAAGAGCTTCAGCCTCCATCTGCACCGCCGTCT
GCACCGCCGTCTGCTCACTCCGAAACACCCTTCATGGAATCAGAGAAGTACCAGAAGCAGTACCCACTGAGCTTC
CGCGATCGTCTCCGCCATTTCACATGGGCATGGTACACCCTCACCATGAGCGCAGGAGGCCTCGCCCTTCTTATA
GCGAACCAGCCGAACAAGTTCACAGGCTACCACGAGATCGGCCTAGCCATCTATCTGATCAACCTCGTCCTCTTC
TCCCTCGTCTGCTCTCTCATGGCAGCGCGATTCATAATCCACGGCGGCGCCCTCAACTCCCTCCGCCACGAACGC
GAGGGCCTCTTCTTCCCAACCTTCTGGCTCTCCGCCGCAACACTGATCACCGGCCTGGAGAAGTACTTCGGCGAG
AACCCCGCCCCATCCTTCACAGCCACACTCGAAGTCCTCTTCTGGATATACTGCTTCTGCACATTCACTCTCGCC
GTTGTACAATACTCCTTCGTCTTCACCTCGCACACCTACCGCCTGCAAACAATGATGCCCTCGTGGATCCTCCCC
GCGTTCCCAATTATGCTAAGCGGGACGATCGCGTCTGTAATCGCCAAAAGCCAGCCCGCGCGCGCAGCAATCCCA
ATCGTCACTGCCGGAATGACCTTCCAAGGTCTAGGCTTCTGCATCTCCTTCATGATGTACTCGCACTACATCGGC
CGGCTGATGGAGAGCGGACTTCCATGTCGGGAACACAGACCGGCGATGTTCATCTGCGTTGGACCACCAGCGTTC
ACCGCGCTTGCTCTCGTGGGTATGGCGCAGGGACTGCCTGCGACGTTCAACGTGATGGGCAGTGAGGACACTACT
GCCGACGGGCGGATGCTGGAGATTCTGGCGTTGGCGGCAGGCGCGTTCTTGTGGGCGCTGAGCTTTTGGTTCTTC
TGTGTCGCTGCTATTGCGGTTATTCGGGCGCCGCCGACGAGCTTCCATCTCAGCTGGTGGGCGATGGTTTTCCCG
AATACTGGGTTTACGATTGCGACCATTACGCTTGGAAATGCGTTTGACAGCTCCGCGATTAAGGGCGTTGGCTCT
GCGATGACTATCTGCATCGTCTGCATGTTCCTCTTCGTCTTTGTCAACCATGGTCTTGCAGTCTATCGCCAGGAT
ATTATGTATCCTGGTAAAGATGAGGATACCTCGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail