Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8482.t1
Gene name
Locationscaffold_33:191361..192729
Strand-
Gene length (bp)1368
Transcript length (bp)1368
Coding sequence length (bp)1368
Protein length (aa) 456

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07228 SpoIIE Stage II sporulation protein E (SpoIIE) 3.7E-10 162 341
PF13672 PP2C_2 Protein phosphatase 2C 3.1E-07 157 338

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0140096 catalytic activity, acting on a protein No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8482.t1
MIPPSVSCRACSSACSSLQAIVRDGVYSISTNPNAYNSSLFKTQHVRFSSHAAGVRPDAHLSLNLTHQPSRRAFH
TTLATHLEKPSPSKLSYRVAVSSSGKGRRFHPIKNAYNFDPAADAIGVSSDKNSVSRRRNRPDSGEDAFFVSRIG
NRISDYQETNAEAVAFGVADGVGGWTESRVDPADFSHGLCNYMAHTAQTWHEPAERLRSKYLLQAGYDQVVADST
IRAGGSTASIGVALPDGRVELANLGDSGSVLLRRAAVHHYSIPQTHGFNTPYQLSVIPPRMRAQASVFGGAFLED
FPSDASVTNVQMQNGDVLIIATDGVFDNINNQDILKLVTSRMVLTGAWTATESGVGVSENLRALAAPGGLAGALP
TPPGSPLSKNPAHTESGPEDGVTLQSVLAATIAGEAKIASIDYRRDGPFAKEAQRYYPGDYYRGGKVDDICVVVV
IAVDA*
Coding >Pro_DTO377G3_2|g8482.t1
ATGATTCCGCCAAGTGTCTCGTGTCGAGCCTGCAGTTCCGCCTGCAGCAGCCTCCAAGCCATCGTCCGCGATGGC
GTATATTCAATCTCCACCAATCCGAACGCATACAATTCCTCGCTGTTCAAAACCCAACATGTCCGCTTCTCGTCT
CACGCCGCAGGAGTCAGACCAGATGCTCACCTCAGCCTGAATCTAACCCATCAACCCTCGCGTCGAGCCTTCCAC
ACAACGCTAGCAACCCACCTAGAGAAACCCTCTCCCTCGAAACTTTCCTACCGCGTCGCCGTCTCCTCCTCCGGC
AAAGGCCGCCGCTTCCACCCCATCAAAAATGCATACAATTTCGACCCTGCCGCAGACGCCATAGGCGTTTCAAGT
GACAAAAACTCCGTCAGTCGCCGTCGCAACCGCCCAGACTCCGGCGAAGACGCTTTCTTCGTAAGCCGTATCGGA
AATCGCATCTCAGACTACCAAGAAACAAACGCCGAAGCAGTCGCCTTCGGCGTCGCAGATGGCGTAGGTGGCTGG
ACGGAATCTCGCGTCGACCCAGCCGACTTCTCCCACGGCTTGTGCAACTACATGGCGCACACCGCACAGACCTGG
CACGAGCCCGCCGAGCGCTTGCGCTCTAAATACCTCCTGCAGGCCGGGTACGACCAGGTGGTGGCGGATTCGACG
ATCCGGGCAGGTGGGAGTACGGCCTCTATTGGCGTCGCCTTGCCGGATGGACGGGTCGAGTTGGCCAATTTGGGT
GATTCTGGCTCGGTGTTGTTGAGGAGGGCCGCGGTGCATCATTACTCGATTCCGCAGACGCATGGTTTCAACACC
CCGTACCAGCTTAGTGTGATCCCGCCGCGTATGCGCGCCCAGGCGTCTGTCTTTGGCGGGGCGTTTTTGGAGGAT
TTCCCTAGTGATGCGTCCGTTACGAATGTGCAGATGCAGAATGGGGATGTACTCATTATTGCTACCGATGGTGTT
TTTGATAATATCAATAATCAGGACATTCTCAAGCTCGTCACGAGCCGTATGGTTCTGACGGGCGCGTGGACGGCT
ACGGAGTCTGGCGTCGGAGTCTCGGAGAATCTGCGTGCACTCGCTGCGCCGGGTGGATTGGCTGGTGCTCTTCCG
ACTCCGCCAGGCTCGCCGCTTTCCAAGAACCCGGCTCACACCGAGTCCGGACCTGAGGATGGAGTCACCTTGCAG
TCTGTTCTCGCGGCGACGATTGCTGGCGAGGCGAAGATTGCTAGTATCGACTATCGTCGTGATGGGCCCTTTGCT
AAGGAGGCTCAGCGCTACTACCCCGGTGACTATTACCGCGGCGGGAAAGTTGATGATATCTGCGTCGTGGTTGTC
ATCGCTGTCGATGCATGA
Transcript >Pro_DTO377G3_2|g8482.t1
ATGATTCCGCCAAGTGTCTCGTGTCGAGCCTGCAGTTCCGCCTGCAGCAGCCTCCAAGCCATCGTCCGCGATGGC
GTATATTCAATCTCCACCAATCCGAACGCATACAATTCCTCGCTGTTCAAAACCCAACATGTCCGCTTCTCGTCT
CACGCCGCAGGAGTCAGACCAGATGCTCACCTCAGCCTGAATCTAACCCATCAACCCTCGCGTCGAGCCTTCCAC
ACAACGCTAGCAACCCACCTAGAGAAACCCTCTCCCTCGAAACTTTCCTACCGCGTCGCCGTCTCCTCCTCCGGC
AAAGGCCGCCGCTTCCACCCCATCAAAAATGCATACAATTTCGACCCTGCCGCAGACGCCATAGGCGTTTCAAGT
GACAAAAACTCCGTCAGTCGCCGTCGCAACCGCCCAGACTCCGGCGAAGACGCTTTCTTCGTAAGCCGTATCGGA
AATCGCATCTCAGACTACCAAGAAACAAACGCCGAAGCAGTCGCCTTCGGCGTCGCAGATGGCGTAGGTGGCTGG
ACGGAATCTCGCGTCGACCCAGCCGACTTCTCCCACGGCTTGTGCAACTACATGGCGCACACCGCACAGACCTGG
CACGAGCCCGCCGAGCGCTTGCGCTCTAAATACCTCCTGCAGGCCGGGTACGACCAGGTGGTGGCGGATTCGACG
ATCCGGGCAGGTGGGAGTACGGCCTCTATTGGCGTCGCCTTGCCGGATGGACGGGTCGAGTTGGCCAATTTGGGT
GATTCTGGCTCGGTGTTGTTGAGGAGGGCCGCGGTGCATCATTACTCGATTCCGCAGACGCATGGTTTCAACACC
CCGTACCAGCTTAGTGTGATCCCGCCGCGTATGCGCGCCCAGGCGTCTGTCTTTGGCGGGGCGTTTTTGGAGGAT
TTCCCTAGTGATGCGTCCGTTACGAATGTGCAGATGCAGAATGGGGATGTACTCATTATTGCTACCGATGGTGTT
TTTGATAATATCAATAATCAGGACATTCTCAAGCTCGTCACGAGCCGTATGGTTCTGACGGGCGCGTGGACGGCT
ACGGAGTCTGGCGTCGGAGTCTCGGAGAATCTGCGTGCACTCGCTGCGCCGGGTGGATTGGCTGGTGCTCTTCCG
ACTCCGCCAGGCTCGCCGCTTTCCAAGAACCCGGCTCACACCGAGTCCGGACCTGAGGATGGAGTCACCTTGCAG
TCTGTTCTCGCGGCGACGATTGCTGGCGAGGCGAAGATTGCTAGTATCGACTATCGTCGTGATGGGCCCTTTGCT
AAGGAGGCTCAGCGCTACTACCCCGGTGACTATTACCGCGGCGGGAAAGTTGATGATATCTGCGTCGTGGTTGTC
ATCGCTGTCGATGCATGA
Gene >Pro_DTO377G3_2|g8482.t1
ATGATTCCGCCAAGTGTCTCGTGTCGAGCCTGCAGTTCCGCCTGCAGCAGCCTCCAAGCCATCGTCCGCGATGGC
GTATATTCAATCTCCACCAATCCGAACGCATACAATTCCTCGCTGTTCAAAACCCAACATGTCCGCTTCTCGTCT
CACGCCGCAGGAGTCAGACCAGATGCTCACCTCAGCCTGAATCTAACCCATCAACCCTCGCGTCGAGCCTTCCAC
ACAACGCTAGCAACCCACCTAGAGAAACCCTCTCCCTCGAAACTTTCCTACCGCGTCGCCGTCTCCTCCTCCGGC
AAAGGCCGCCGCTTCCACCCCATCAAAAATGCATACAATTTCGACCCTGCCGCAGACGCCATAGGCGTTTCAAGT
GACAAAAACTCCGTCAGTCGCCGTCGCAACCGCCCAGACTCCGGCGAAGACGCTTTCTTCGTAAGCCGTATCGGA
AATCGCATCTCAGACTACCAAGAAACAAACGCCGAAGCAGTCGCCTTCGGCGTCGCAGATGGCGTAGGTGGCTGG
ACGGAATCTCGCGTCGACCCAGCCGACTTCTCCCACGGCTTGTGCAACTACATGGCGCACACCGCACAGACCTGG
CACGAGCCCGCCGAGCGCTTGCGCTCTAAATACCTCCTGCAGGCCGGGTACGACCAGGTGGTGGCGGATTCGACG
ATCCGGGCAGGTGGGAGTACGGCCTCTATTGGCGTCGCCTTGCCGGATGGACGGGTCGAGTTGGCCAATTTGGGT
GATTCTGGCTCGGTGTTGTTGAGGAGGGCCGCGGTGCATCATTACTCGATTCCGCAGACGCATGGTTTCAACACC
CCGTACCAGCTTAGTGTGATCCCGCCGCGTATGCGCGCCCAGGCGTCTGTCTTTGGCGGGGCGTTTTTGGAGGAT
TTCCCTAGTGATGCGTCCGTTACGAATGTGCAGATGCAGAATGGGGATGTACTCATTATTGCTACCGATGGTGTT
TTTGATAATATCAATAATCAGGACATTCTCAAGCTCGTCACGAGCCGTATGGTTCTGACGGGCGCGTGGACGGCT
ACGGAGTCTGGCGTCGGAGTCTCGGAGAATCTGCGTGCACTCGCTGCGCCGGGTGGATTGGCTGGTGCTCTTCCG
ACTCCGCCAGGCTCGCCGCTTTCCAAGAACCCGGCTCACACCGAGTCCGGACCTGAGGATGGAGTCACCTTGCAG
TCTGTTCTCGCGGCGACGATTGCTGGCGAGGCGAAGATTGCTAGTATCGACTATCGTCGTGATGGGCCCTTTGCT
AAGGAGGCTCAGCGCTACTACCCCGGTGACTATTACCGCGGCGGGAAAGTTGATGATATCTGCGTCGTGGTTGTC
ATCGCTGTCGATGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail