Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8479.t1
Gene name
Locationscaffold_33:185466..186895
Strand+
Gene length (bp)1429
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 3.2E-07 154 206
PF14378 PAP2_3 PAP2 superfamily 1.4E-14 234 325
PF14378 PAP2_3 PAP2 superfamily 8.9E-07 352 395

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 115 137 22
3 184 206 22
4 242 264 22
5 309 331 22
6 352 374 22
7 384 406 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8479.t1
MGAGMVIEPLVVIVLLFGGTWINRSVGSSSTKSYNRRNSNDLGRAASFDSLESGYSSQSTKDGLLSPRSHSPQAP
EDGWHKRQVGLLGLNFEVSSPNTIVFQDSLLSRLLRKFPFLVECWYWALVYWTYQLGRAFTAVTLKDDTVDVARR
HALQLIVIEENLGIFWETLIQRRFLRHPLVMPWINWMYSFIHIPGTIAFLVWLYYYTTVRNRIDEAQPGKPKGAM
SGSPAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDTAVDGDEGDLARSYGFVDTVHGIKGSGSVWTENR
FCNQYAAMPSLHFGYSLLIGLTLITIPLPQHHRHTILRTRLTRALRLELPSWRRLVCVILGFLYPFTILVAIVAT
ANHFILDAVAGALVCALGWYFNGVLLNLLPLEDYFLCLVRIHKPEPSLLDVHEEECPTTESV*
Coding >Pro_DTO377G3_2|g8479.t1
ATGGGAGCTGGAATGGTCATCGAGCCTTTGGTGGTTATTGTTCTCTTATTTGGAGGCACCTGGATTAACCGCTCT
GTCGGATCATCCTCGACTAAAAGCTACAACCGACGGAACTCGAACGACCTTGGACGAGCCGCTTCATTTGATTCT
TTGGAGTCGGGTTACTCAAGCCAATCGACAAAGGATGGTCTGCTGAGCCCTCGCTCCCACTCACCACAAGCCCCG
GAAGACGGATGGCACAAGCGACAAGTTGGACTTTTAGGGTTGAATTTCGAGGTATCCTCGCCGAATACGATTGTA
TTCCAAGACAGTTTGCTCAGTCGATTGCTTCGGAAGTTTCCTTTCTTGGTGGAATGTTGGTATTGGGCTTTGGTT
TACTGGACGTACCAGCTCGGTCGTGCCTTTACCGCCGTGACTCTCAAGGATGACACCGTTGATGTCGCGAGGAGG
CATGCATTGCAACTAATCGTGATCGAGGAGAATCTGGGAATATTCTGGGAGACCTTGATACAGAGACGCTTCCTT
CGCCATCCTCTTGTCATGCCTTGGATCAATTGGATGTACTCGTTCATACACATTCCTGGGACAATCGCGTTTCTC
GTTTGGCTCTATTACTATACTACCGTGCGGAATCGGATCGACGAGGCTCAGCCCGGAAAGCCCAAGGGAGCTATG
AGCGGGTCGCCTGCAGGTCCTCTTCTATACCAGGCGCGTCGGCGGACTTTGGCCGTGTGCAATCTCCTCGCATTC
GTGGTGTTCACTCTTTGGCCTTGCATGCCACCTCGGTTACTGAGTGATACAGCCGTGGATGGTGACGAGGGAGAT
CTAGCCCGCAGTTATGGGTTCGTGGACACGGTGCATGGTATCAAGGGATCGGGCAGTGTGTGGACCGAAAACCGC
TTCTGTAACCAATATGCGGCGATGCCTTCCTTGCATTTCGGCTACTCTTTATTGATCGGCCTCACACTGATCACA
ATCCCTTTGCCGCAGCACCACCGGCACACAATCCTGCGTACTCGGCTGACCCGTGCCTTAAGACTGGAGCTCCCG
TCGTGGCGCCGCCTCGTTTGCGTCATACTCGGCTTCCTATATCCGTTTACCATCCTTGTAGCTATTGTTGCCACT
GCCAACCATTTTATTCTGGATGCTGTCGCAGGAGCGCTTGTATGTGCCTTGGGGTGGTATTTTAATGGGGTGCTG
CTCAACCTGTTGCCACTGGAAGACTACTTCCTTTGCCTTGTCCGGATCCATAAGCCTGAGCCGTCACTTCTCGAT
GTCCACGAGGAGGAGTGTCCCACGACCGAAAGTGTTTGA
Transcript >Pro_DTO377G3_2|g8479.t1
ATGGGAGCTGGAATGGTCATCGAGCCTTTGGTGGTTATTGTTCTCTTATTTGGAGGCACCTGGATTAACCGCTCT
GTCGGATCATCCTCGACTAAAAGCTACAACCGACGGAACTCGAACGACCTTGGACGAGCCGCTTCATTTGATTCT
TTGGAGTCGGGTTACTCAAGCCAATCGACAAAGGATGGTCTGCTGAGCCCTCGCTCCCACTCACCACAAGCCCCG
GAAGACGGATGGCACAAGCGACAAGTTGGACTTTTAGGGTTGAATTTCGAGGTATCCTCGCCGAATACGATTGTA
TTCCAAGACAGTTTGCTCAGTCGATTGCTTCGGAAGTTTCCTTTCTTGGTGGAATGTTGGTATTGGGCTTTGGTT
TACTGGACGTACCAGCTCGGTCGTGCCTTTACCGCCGTGACTCTCAAGGATGACACCGTTGATGTCGCGAGGAGG
CATGCATTGCAACTAATCGTGATCGAGGAGAATCTGGGAATATTCTGGGAGACCTTGATACAGAGACGCTTCCTT
CGCCATCCTCTTGTCATGCCTTGGATCAATTGGATGTACTCGTTCATACACATTCCTGGGACAATCGCGTTTCTC
GTTTGGCTCTATTACTATACTACCGTGCGGAATCGGATCGACGAGGCTCAGCCCGGAAAGCCCAAGGGAGCTATG
AGCGGGTCGCCTGCAGGTCCTCTTCTATACCAGGCGCGTCGGCGGACTTTGGCCGTGTGCAATCTCCTCGCATTC
GTGGTGTTCACTCTTTGGCCTTGCATGCCACCTCGGTTACTGAGTGATACAGCCGTGGATGGTGACGAGGGAGAT
CTAGCCCGCAGTTATGGGTTCGTGGACACGGTGCATGGTATCAAGGGATCGGGCAGTGTGTGGACCGAAAACCGC
TTCTGTAACCAATATGCGGCGATGCCTTCCTTGCATTTCGGCTACTCTTTATTGATCGGCCTCACACTGATCACA
ATCCCTTTGCCGCAGCACCACCGGCACACAATCCTGCGTACTCGGCTGACCCGTGCCTTAAGACTGGAGCTCCCG
TCGTGGCGCCGCCTCGTTTGCGTCATACTCGGCTTCCTATATCCGTTTACCATCCTTGTAGCTATTGTTGCCACT
GCCAACCATTTTATTCTGGATGCTGTCGCAGGAGCGCTTGTATGTGCCTTGGGGTGGTATTTTAATGGGGTGCTG
CTCAACCTGTTGCCACTGGAAGACTACTTCCTTTGCCTTGTCCGGATCCATAAGCCTGAGCCGTCACTTCTCGAT
GTCCACGAGGAGGAGTGTCCCACGACCGAAAGTGTTTGA
Gene >Pro_DTO377G3_2|g8479.t1
ATGGGAGCTGGAATGGTCATCGAGCCTTTGGTGGTTATTGTTCTCTTATTTGGAGGCACCTGGATTAACCGCTCT
GTCGGATCATCCTCGACTAAAAGCTACAACCGACGGAACTCGAACGACCTTGGACGAGCCGCTTCATTTGATTCT
TTGGAGTCGGGTTACTCAAGCCAATCGACAAAGGATGGTCTGCTGAGCCCTCGCTCCCACTCACCACAAGCCCCG
GAAGACGGATGGCACAAGCGACAAGTTGGACTTTTAGGGTTGAATTTCGAGGTATCCTCGCCGAATACGATTGTA
TTCCAAGACAGTTTGCTCAGTCGATTGCTTCGGAAGTTTCCTTTCTTGGTGGAATGTTGGTATTGGGCTTTGGTT
TACTGGGTAGGTTGATTTGCTCCTTAACTTACCATCGGTCTTGGCTAAACCAAACTCACAATTTGTATAGACGTA
CCAGCTCGGTCGTGCCTTTACCGCCGTGACTCTCAAGGATGACACCGTTGATGTCGCGAGGAGGCATGCATTGCA
ACTAATCGTGATCGAGGAGAATCTGGGAATATTCTGGGAGACCTTGATACAGAGACGCTTCCTTCGCCATCCTCT
TGTCATGCCTTGGATCAATTGGATGTACTCGTTCATACACATTCCTGGGACAATCGCGTTTCTCGTTTGGCTCTA
TTACTATACTACCGTGCGGAATCGGATCGACGAGGCTCAGCCCGGAAAGCCCAAGGGAGCTATGAGCGGGTCGCC
TGCAGGTCCTCTTCTATACCAGGCGCGTCGGCGGACTTTGGCCGTGTGCAATCTCCTCGCATTCGTGGTGTTCAC
TCTTTGGCCTTGCATGCCACCTCGGTTACTGAGTGATACAGCCGTGGATGGTGACGAGGGAGATCTAGCCCGCAG
TTATGGGTTCGTGGACACGGTGCATGGTATCAAGGGATCGGGCAGTGTGTGGACCGAAAACCGCTTCTGTAACCA
ATATGGCAAGTGTTGTCTGGAATCCTCTCTATGAATCCTTGGCTAACTGTTACCAGCGGCGATGCCTTCCTTGCA
TTTCGGCTACTCTTTATTGATCGGCCTCACACTGATCACAATCCCTTTGCCGCAGCACCACCGGCACACAATCCT
GCGTACTCGGCTGACCCGTGCCTTAAGACTGGAGCTCCCGTCGTGGCGCCGCCTCGTTTGCGTCATACTCGGCTT
CCTATATCCGTTTACCATCCTTGTAGCTATTGTTGCCACTGCCAACCATTTTATTCTGGATGCTGTCGCAGGAGC
GCTTGTATGTGCCTTGGGGTGGTATTTTAATGGGGTGCTGCTCAACCTGTTGCCACTGGAAGACTACTTCCTTTG
CCTTGTCCGGATCCATAAGCCTGAGCCGTCACTTCTCGATGTCCACGAGGAGGAGTGTCCCACGACCGAAAGTGT
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail