Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8476.t1
Gene name
Locationscaffold_33:176522..179974
Strand+
Gene length (bp)3452
Transcript length (bp)3324
Coding sequence length (bp)3324
Protein length (aa) 1108

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 6.1E-10 9 48
PF00018 SH3_1 SH3 domain 1.4E-05 74 119
PF00018 SH3_1 SH3 domain 7.9E-13 404 450
PF03983 SHD1 SLA1 homology domain 1, SHD1 1.3E-31 511 575
PF14604 SH3_9 Variant SH3 domain 2.6E-11 9 65
PF14604 SH3_9 Variant SH3 domain 1.0E-07 404 454
PF07653 SH3_2 Variant SH3 domain 6.7E-07 9 67

GO

GO Term Description Terminal node
GO:0030674 protein binding, bridging Yes
GO:0005515 protein binding Yes
GO:0043130 ubiquitin binding Yes
GO:0042802 identical protein binding Yes
GO:0008092 cytoskeletal protein binding Yes
GO:0005488 binding No
GO:0032182 ubiquitin-like protein binding No
GO:0060090 molecular adaptor activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8476.t1
MGFIGVYSAVYDYQPQGAGELEIHEGDLLYILEKNADDAWWRAKKKASREDEDEPEGLVPNNYVEEVQPAHRATA
LFDYTRQTDEEISFSEDAELMVYDTSDPDWTLVGANSEYGFAPSNYIEIIEDTSAETTPPPQPSVRAEPAAPTLP
QRPTQTASEETEASPAASPVDMSHNPAAAAIASIIHKQHAPARVSAETTRDEPPPPSLPVRPSYDQEEDHEESPP
PSLPRRPPSEHASPTMNRYSPDPTPPRPQQAAPAMGRDRTHVKASPPYNRAGEMTPRSPSGYHIYNINEMVEVMG
KRKKMPTTLGINMATGIIFISPEGDDRQKEWSAEKLTHYSIEGKHVFVDLVRPSKSIDFHAGAKDTAHEIAAALG
EIAGAYRAEGLREVIEAGEGGGPKKGQILYDFMAQGDDEVTVAVGDEVIILDDTKSEEWWMVRRLKNNKEGVVPS
SYVEVIGLIPKAPLMPHEPGLSSVEKNRMEEMRLSKLAIGKSRTDSMDSSDRHSKRDSKIKSKPDMTKVRRWTDR
TKDFTVEAQFIGLQDGKIQLHKVNGIKIAVPVSKMSVEDLEHVEKVAGVSLDEDKPLSSIRPRVTIGNDSKAGAS
VQRSDYDWFDFFLKAGVGPHRCERYAQSFNKDAMDESVLPDITSEILQTLGLNQGDTLRVMKVLDAKYGRAPDKT
KLRNVSFGGEEVIGNGEDGGQGGLFSGPGGVLRNNTRRARPTPNVPAGEVDPKAFGQGEEPKSSDSSASPPPAAA
EKPAAGFEDDAWEVKQPKQPAGPPAATPTPPPAAAQVPQPTGAMADLTLLQAPLQPTPAQPTAPAAPPIPTLQPQ
ATAVQSPAIQAQQTGATPSLFAQVAQIGQYQRSFSPQQTGFQAQARQRPQAPPTVGHNSLLPPPPQRPLSAPQNF
SQLQNSFGPPPLQAQLTGLPQAGPPVAPPGQSLTEINQLRYQAAMQPQATGFMGQPQYQNGLMPQPTGFTPQSQF
GIQQQQQQLPFGSQMAPQQTGFQGLGPQPTGFGGYGQFQQPMQTGINSVLPPALQPQPTGVNGYGNQSYTSPPPV
PPIPQQPTATPLSPQKTGPAPPIRFGVKPDGPKKLEPQPTGLRANLSQATPNNPFGF*
Coding >Pro_DTO377G3_2|g8476.t1
ATGGGTTTCATCGGTGTATACTCGGCTGTGTACGACTACCAGCCACAGGGAGCGGGCGAACTCGAGATTCACGAG
GGCGACCTCCTCTACATTTTGGAAAAGAATGCGGATGATGCCTGGTGGAGGGCTAAAAAGAAGGCTAGTCGGGAG
GATGAGGACGAACCTGAAGGCCTAGTTCCCAACAACTATGTCGAAGAGGTGCAACCAGCGCACAGAGCTACAGCC
CTCTTCGACTATACGCGACAGACCGACGAGGAGATTTCCTTCTCAGAAGATGCTGAGCTGATGGTGTATGACACC
TCGGATCCAGACTGGACGTTGGTTGGAGCCAACTCGGAGTATGGGTTTGCGCCGTCGAATTACATCGAAATCATC
GAGGATACCTCCGCTGAAACTACTCCCCCTCCTCAACCTTCTGTTCGAGCCGAGCCTGCCGCGCCGACGCTTCCG
CAGCGGCCGACGCAGACTGCATCGGAAGAAACCGAGGCATCCCCCGCCGCCTCTCCGGTTGATATGTCTCACAAC
CCCGCTGCTGCTGCGATCGCCAGCATCATCCATAAGCAGCATGCCCCTGCGAGGGTATCTGCCGAGACGACCAGA
GATGAACCCCCGCCACCCAGTCTTCCCGTCCGACCATCGTACGATCAAGAAGAGGACCACGAGGAGTCTCCGCCG
CCTAGTCTGCCACGTCGACCACCTTCGGAACATGCGTCCCCCACTATGAACCGTTACTCGCCTGACCCAACTCCG
CCACGTCCCCAGCAGGCGGCGCCTGCCATGGGTCGTGATCGGACACATGTCAAAGCATCACCCCCTTACAACCGG
GCAGGTGAGATGACGCCTCGGTCCCCTTCCGGCTATCATATCTACAATATCAATGAGATGGTTGAAGTGATGGGC
AAGAGAAAGAAGATGCCGACGACATTGGGAATCAACATGGCTACTGGAATCATCTTTATCTCTCCTGAAGGCGAT
GATCGGCAGAAAGAATGGAGTGCAGAGAAGCTCACTCATTACTCGATCGAAGGCAAGCATGTCTTTGTTGACCTT
GTCAGACCTAGCAAAAGTATCGATTTCCATGCAGGTGCCAAAGACACTGCCCACGAGATTGCAGCGGCACTCGGC
GAGATCGCCGGTGCCTACCGGGCAGAAGGACTGCGTGAGGTGATCGAGGCAGGAGAAGGGGGCGGTCCCAAGAAG
GGCCAGATCCTGTATGACTTTATGGCGCAAGGTGATGATGAAGTTACAGTAGCTGTGGGGGACGAGGTCATCATC
CTTGATGATACTAAGTCTGAAGAGTGGTGGATGGTGCGGCGATTGAAGAACAACAAGGAGGGTGTTGTCCCTAGT
AGCTATGTTGAAGTCATAGGATTGATACCGAAGGCGCCTTTGATGCCTCATGAACCAGGTTTGTCGAGTGTGGAA
AAGAACCGGATGGAGGAGATGCGGCTGTCCAAACTTGCGATCGGCAAGTCACGGACGGACTCCATGGATTCATCG
GACCGTCACAGCAAGCGCGACAGCAAAATCAAGTCGAAGCCCGATATGACTAAGGTGCGAAGGTGGACGGATCGG
ACCAAGGATTTCACAGTGGAAGCCCAGTTCATAGGCCTCCAGGATGGTAAAATCCAGCTTCACAAGGTGAACGGT
ATCAAGATTGCCGTCCCTGTCTCAAAGATGTCAGTTGAAGATCTCGAGCATGTGGAGAAAGTTGCCGGCGTCTCG
CTAGATGAGGACAAACCTCTTTCAAGCATCCGACCTCGCGTTACCATTGGCAATGATTCCAAAGCTGGGGCTTCT
GTGCAACGTTCCGATTACGATTGGTTTGACTTCTTCCTTAAGGCTGGCGTTGGGCCACATCGCTGTGAGCGATAC
GCACAGTCATTTAACAAGGACGCGATGGACGAATCTGTGCTGCCGGACATTACATCTGAAATCCTTCAGACTCTG
GGTCTAAACCAGGGTGATACCTTGCGAGTAATGAAGGTTTTGGATGCCAAATATGGCCGTGCCCCGGACAAGACC
AAGCTTCGAAATGTCAGTTTCGGTGGTGAGGAAGTCATTGGCAATGGCGAGGACGGAGGGCAAGGTGGTCTGTTT
TCCGGGCCCGGTGGTGTGCTGCGCAACAACACTCGCAGGGCCAGACCAACACCAAACGTTCCAGCCGGAGAGGTC
GATCCCAAGGCGTTCGGGCAGGGAGAGGAACCTAAATCATCAGACAGCTCGGCAAGCCCACCACCTGCAGCAGCT
GAAAAGCCTGCAGCCGGATTTGAAGATGATGCTTGGGAGGTGAAGCAGCCGAAGCAACCTGCTGGGCCACCTGCA
GCCACCCCGACGCCACCGCCTGCGGCAGCTCAGGTTCCTCAGCCAACAGGGGCAATGGCGGATCTGACTTTGCTT
CAAGCTCCTTTGCAGCCGACGCCGGCTCAGCCTACTGCACCAGCTGCCCCGCCTATACCCACCCTGCAGCCGCAG
GCCACTGCCGTGCAATCACCAGCTATACAGGCTCAACAAACAGGTGCCACTCCTAGCTTGTTTGCGCAAGTGGCA
CAGATAGGACAGTATCAACGATCTTTCAGCCCTCAACAGACCGGGTTCCAAGCACAGGCCAGACAACGCCCACAG
GCCCCTCCGACAGTTGGGCATAATTCACTTCTGCCTCCGCCCCCGCAACGCCCACTGTCCGCGCCTCAGAACTTC
TCGCAACTGCAAAACTCCTTTGGCCCTCCTCCATTGCAAGCTCAACTGACGGGCCTTCCCCAGGCGGGTCCTCCG
GTTGCTCCTCCTGGCCAGAGTCTGACCGAAATAAACCAGCTACGTTACCAAGCCGCGATGCAGCCGCAAGCGACA
GGATTTATGGGTCAACCTCAATATCAGAATGGCTTGATGCCGCAGCCCACCGGGTTTACTCCCCAGTCACAATTC
GGTATCCAGCAACAGCAACAGCAACTGCCGTTTGGTAGCCAGATGGCCCCTCAACAAACTGGATTCCAGGGACTT
GGGCCACAGCCCACAGGCTTTGGTGGATATGGGCAATTCCAACAACCAATGCAGACTGGTATCAACTCTGTCCTT
CCCCCTGCACTGCAACCGCAACCCACTGGTGTCAATGGCTACGGCAACCAGTCCTACACATCTCCGCCTCCTGTG
CCGCCAATTCCCCAGCAACCAACAGCGACCCCCCTGTCACCACAGAAGACCGGACCGGCTCCCCCCATCAGATTT
GGTGTCAAGCCAGATGGTCCCAAGAAGCTTGAGCCACAACCGACTGGACTCAGAGCCAACCTTTCGCAAGCTACC
CCCAATAATCCGTTCGGCTTCTAA
Transcript >Pro_DTO377G3_2|g8476.t1
ATGGGTTTCATCGGTGTATACTCGGCTGTGTACGACTACCAGCCACAGGGAGCGGGCGAACTCGAGATTCACGAG
GGCGACCTCCTCTACATTTTGGAAAAGAATGCGGATGATGCCTGGTGGAGGGCTAAAAAGAAGGCTAGTCGGGAG
GATGAGGACGAACCTGAAGGCCTAGTTCCCAACAACTATGTCGAAGAGGTGCAACCAGCGCACAGAGCTACAGCC
CTCTTCGACTATACGCGACAGACCGACGAGGAGATTTCCTTCTCAGAAGATGCTGAGCTGATGGTGTATGACACC
TCGGATCCAGACTGGACGTTGGTTGGAGCCAACTCGGAGTATGGGTTTGCGCCGTCGAATTACATCGAAATCATC
GAGGATACCTCCGCTGAAACTACTCCCCCTCCTCAACCTTCTGTTCGAGCCGAGCCTGCCGCGCCGACGCTTCCG
CAGCGGCCGACGCAGACTGCATCGGAAGAAACCGAGGCATCCCCCGCCGCCTCTCCGGTTGATATGTCTCACAAC
CCCGCTGCTGCTGCGATCGCCAGCATCATCCATAAGCAGCATGCCCCTGCGAGGGTATCTGCCGAGACGACCAGA
GATGAACCCCCGCCACCCAGTCTTCCCGTCCGACCATCGTACGATCAAGAAGAGGACCACGAGGAGTCTCCGCCG
CCTAGTCTGCCACGTCGACCACCTTCGGAACATGCGTCCCCCACTATGAACCGTTACTCGCCTGACCCAACTCCG
CCACGTCCCCAGCAGGCGGCGCCTGCCATGGGTCGTGATCGGACACATGTCAAAGCATCACCCCCTTACAACCGG
GCAGGTGAGATGACGCCTCGGTCCCCTTCCGGCTATCATATCTACAATATCAATGAGATGGTTGAAGTGATGGGC
AAGAGAAAGAAGATGCCGACGACATTGGGAATCAACATGGCTACTGGAATCATCTTTATCTCTCCTGAAGGCGAT
GATCGGCAGAAAGAATGGAGTGCAGAGAAGCTCACTCATTACTCGATCGAAGGCAAGCATGTCTTTGTTGACCTT
GTCAGACCTAGCAAAAGTATCGATTTCCATGCAGGTGCCAAAGACACTGCCCACGAGATTGCAGCGGCACTCGGC
GAGATCGCCGGTGCCTACCGGGCAGAAGGACTGCGTGAGGTGATCGAGGCAGGAGAAGGGGGCGGTCCCAAGAAG
GGCCAGATCCTGTATGACTTTATGGCGCAAGGTGATGATGAAGTTACAGTAGCTGTGGGGGACGAGGTCATCATC
CTTGATGATACTAAGTCTGAAGAGTGGTGGATGGTGCGGCGATTGAAGAACAACAAGGAGGGTGTTGTCCCTAGT
AGCTATGTTGAAGTCATAGGATTGATACCGAAGGCGCCTTTGATGCCTCATGAACCAGGTTTGTCGAGTGTGGAA
AAGAACCGGATGGAGGAGATGCGGCTGTCCAAACTTGCGATCGGCAAGTCACGGACGGACTCCATGGATTCATCG
GACCGTCACAGCAAGCGCGACAGCAAAATCAAGTCGAAGCCCGATATGACTAAGGTGCGAAGGTGGACGGATCGG
ACCAAGGATTTCACAGTGGAAGCCCAGTTCATAGGCCTCCAGGATGGTAAAATCCAGCTTCACAAGGTGAACGGT
ATCAAGATTGCCGTCCCTGTCTCAAAGATGTCAGTTGAAGATCTCGAGCATGTGGAGAAAGTTGCCGGCGTCTCG
CTAGATGAGGACAAACCTCTTTCAAGCATCCGACCTCGCGTTACCATTGGCAATGATTCCAAAGCTGGGGCTTCT
GTGCAACGTTCCGATTACGATTGGTTTGACTTCTTCCTTAAGGCTGGCGTTGGGCCACATCGCTGTGAGCGATAC
GCACAGTCATTTAACAAGGACGCGATGGACGAATCTGTGCTGCCGGACATTACATCTGAAATCCTTCAGACTCTG
GGTCTAAACCAGGGTGATACCTTGCGAGTAATGAAGGTTTTGGATGCCAAATATGGCCGTGCCCCGGACAAGACC
AAGCTTCGAAATGTCAGTTTCGGTGGTGAGGAAGTCATTGGCAATGGCGAGGACGGAGGGCAAGGTGGTCTGTTT
TCCGGGCCCGGTGGTGTGCTGCGCAACAACACTCGCAGGGCCAGACCAACACCAAACGTTCCAGCCGGAGAGGTC
GATCCCAAGGCGTTCGGGCAGGGAGAGGAACCTAAATCATCAGACAGCTCGGCAAGCCCACCACCTGCAGCAGCT
GAAAAGCCTGCAGCCGGATTTGAAGATGATGCTTGGGAGGTGAAGCAGCCGAAGCAACCTGCTGGGCCACCTGCA
GCCACCCCGACGCCACCGCCTGCGGCAGCTCAGGTTCCTCAGCCAACAGGGGCAATGGCGGATCTGACTTTGCTT
CAAGCTCCTTTGCAGCCGACGCCGGCTCAGCCTACTGCACCAGCTGCCCCGCCTATACCCACCCTGCAGCCGCAG
GCCACTGCCGTGCAATCACCAGCTATACAGGCTCAACAAACAGGTGCCACTCCTAGCTTGTTTGCGCAAGTGGCA
CAGATAGGACAGTATCAACGATCTTTCAGCCCTCAACAGACCGGGTTCCAAGCACAGGCCAGACAACGCCCACAG
GCCCCTCCGACAGTTGGGCATAATTCACTTCTGCCTCCGCCCCCGCAACGCCCACTGTCCGCGCCTCAGAACTTC
TCGCAACTGCAAAACTCCTTTGGCCCTCCTCCATTGCAAGCTCAACTGACGGGCCTTCCCCAGGCGGGTCCTCCG
GTTGCTCCTCCTGGCCAGAGTCTGACCGAAATAAACCAGCTACGTTACCAAGCCGCGATGCAGCCGCAAGCGACA
GGATTTATGGGTCAACCTCAATATCAGAATGGCTTGATGCCGCAGCCCACCGGGTTTACTCCCCAGTCACAATTC
GGTATCCAGCAACAGCAACAGCAACTGCCGTTTGGTAGCCAGATGGCCCCTCAACAAACTGGATTCCAGGGACTT
GGGCCACAGCCCACAGGCTTTGGTGGATATGGGCAATTCCAACAACCAATGCAGACTGGTATCAACTCTGTCCTT
CCCCCTGCACTGCAACCGCAACCCACTGGTGTCAATGGCTACGGCAACCAGTCCTACACATCTCCGCCTCCTGTG
CCGCCAATTCCCCAGCAACCAACAGCGACCCCCCTGTCACCACAGAAGACCGGACCGGCTCCCCCCATCAGATTT
GGTGTCAAGCCAGATGGTCCCAAGAAGCTTGAGCCACAACCGACTGGACTCAGAGCCAACCTTTCGCAAGCTACC
CCCAATAATCCGTTCGGCTTCTAA
Gene >Pro_DTO377G3_2|g8476.t1
ATGGGTTTCATCGGTGTATACTCGGCTGTGTACGACTACCAGCCACAGGGAGCGGGCGAACTCGAGATTCACGAG
GGCGACCTCCTCTACATTTTGGAAAAGAATGCGGATGATGCCTGGTGGAGGGCTAAAAAGAAGGCTAGTCGGGAG
GATGAGGACGAACCTGAAGGCCTAGTTCCCAACAACTATGTCGAAGAGGTGAGTCTCCGCCGATGGCACCCGCGC
AGGCCTCGCTGCATGGACAATTGCTGATATTATATGAAACAGGTGCAACCAGCGCACAGAGCTACAGCCCTCTTC
GACTATACGCGACAGACCGACGAGGAGATTTCCTTCTCAGAAGATGCTGAGCTGATGGTGTATGACACCTCGGAT
CCAGACTGGACGTTGGTTGGAGCCAACTCGGAGTATGGGTTTGCGCCGTCGAATTACATCGAAATCATCGAGGAT
ACCTCCGCTGAAACTACTCCCCCTCCTCAACCTTCTGTTCGAGCCGAGCCTGCCGCGCCGACGCTTCCGCAGCGG
CCGACGCAGACTGCATCGGAAGAAACCGAGGCATCCCCCGCCGCCTCTCCGGTTGATATGTCTCACAACCCCGCT
GCTGCTGCGATCGCCAGCATCATCCATAAGCAGCATGCCCCTGCGAGGGTATCTGCCGAGACGACCAGAGATGAA
CCCCCGCCACCCAGTCTTCCCGTCCGACCATCGTACGATCAAGAAGAGGACCACGAGGAGTCTCCGCCGCCTAGT
CTGCCACGTCGACCACCTTCGGAACATGCGTCCCCCACTATGAACCGTTACTCGCCTGACCCAACTCCGCCACGT
CCCCAGCAGGCGGCGCCTGCCATGGGTCGTGATCGGACACATGTCAAAGCATCACCCCCTTACAACCGGGCAGGT
GAGATGACGCCTCGGTCCCCTTCCGGCTATCATATCTACAATATCAATGAGATGGTTGAAGTGATGGGCAAGAGA
AAGAAGATGCCGACGACATTGGGAATCAACATGGCTACTGGAATCATCTTTATCTCTCCTGAAGGCGATGATCGG
CAGAAAGAATGGAGTGCAGAGAAGCTCACTCATTACTCGATCGAAGGCAAGCATGTCTTTGTTGACCTTGTCAGA
CCTAGCAAAAGTATCGATTTCCATGCAGGTGCCAAAGACACTGCCCACGAGATTGCAGCGGCACTCGGCGAGATC
GCCGGTGCCTACCGGGCAGAAGGACTGCGTGAGGTGATCGAGGCAGGAGAAGGGGGCGGTCCCAAGAAGGGCCAG
ATCCTGTATGACTTTATGGCGCAAGGTGATGATGAAGTTACAGTAGCTGTGGGGGACGAGGTCATCATCCTTGAT
GATACTAAGTCTGAAGAGTGGTGGATGGTGCGGCGATTGAAGAACAACAAGGAGGGTGTTGTCCCTAGTAGCTAT
GTTGAAGTCATAGGATTGATACCGAAGGCGCCTTTGATGCCTCATGAACCAGGTTTGTCGAGTGTGGAAAAGAAC
CGGATGGAGGAGATGCGGCTGTCCAAACTTGCGATCGGCAAGTCACGGACGGACTCCATGGATTCATCGGACCGT
CACAGCAAGCGCGACAGCAAAATCAAGTCGAAGCCCGATATGACTAAGGTGCGAAGGTGGACGGATCGGACCAAG
GATTTCACAGTGGAAGCCCAGTTCATAGGCCTCCAGGATGGTAAAATCCAGCTTCACAAGGTGAACGGTATCAAG
ATTGCCGTCCCTGTCTCAAAGATGTCAGTTGAAGATCTCGAGCATGTGGAGAAAGTTGCCGGCGTCTCGCTAGAT
GAGGACAAACCTCTTTCAAGCATCCGACCTCGCGTTACCATTGGCAATGATTCCAAAGCTGGGGCTTCTGTGCAA
CGTTCCGATTACGATTGGTTTGACTTCTTCCTTAAGGCTGGCGTTGGGCCACATCGCTGTGAGCGATACGCACAG
TCATTTAACAAGGACGCGATGGACGAATCTGTGCTGCCGGACATTACATCTGAAATCCTTCAGACTCTGGGTCTA
AACCAGGGTGATACCTTGCGAGTAATGAAGGTTTTGGATGCCAAATATGGCCGTGCCCCGGACAAGACCAAGCTT
CGAAATGTCAGTTTCGGTGGTGAGGAAGTCATTGGCAATGGCGAGGACGGAGGGCAAGGTGGTCTGTTTTCCGGG
CCCGGTGGTGTGCTGCGCAACAACACTCGCAGGGCCAGACCAACACCAAACGTTCCAGCCGGAGAGGTCGATCCC
AAGGCGTTCGGGCAGGGAGAGGAACCTAAATCATCAGACAGCTCGGCAAGCCCACCACCTGCAGCAGCTGAAAAG
CCTGCAGCCGGATTTGAAGATGATGCTTGGGAGGTGAAGCAGCCGAAGCAACCTGCTGGGCCACCTGCAGCCACC
CCGACGCCACCGCCTGCGGCAGCTCAGGTTCCTCAGCCAACAGGGGCAATGGCGGATCTGACTTTGCTTCAAGCT
CCTTTGCAGCCGACGCCGGCTCAGCCTACTGCACCAGCTGCCCCGCCTATACCCACCCTGCAGCCGCAGGCCACT
GCCGTGCAATCACCAGCTATACAGGCTCAACAAACAGGTGCCACTCCTAGCTTGTTTGCGCAAGTGGCACAGATA
GGACAGTATCAACGATCTTTCAGCCCTCAACAGACCGGGTTCCAAGCACAGGCCAGACAACGCCCACAGGCCCCT
CCGACAGTTGGGCATAATTCACTTCTGCCTCCGCCCCCGCAACGCCCACTGTCCGCGCCTCAGAACTTCTCGCAA
CTGCAAAACTCCTTTGGCCCTCCTCCATTGCAAGCTCAACTGACGGGCCTTCCCCAGGCGGGTCCTCCGGTTGCT
CCTCCTGGCCAGAGTCTGACCGAAATAAACCAGCTACGTTACCAAGCCGCGATGCAGCCGCAAGCGACAGGATTT
ATGGGTCAACCTCAATATCAGAATGGCTTGATGCCGCAGCCCACCGGGTTTACTCCCCAGTCACAATTCGGTATC
CAGCAACAGCAACAGCAACTGCCGTTTGGTAGCCAGATGGCCCCTCAACAAACTGGATTCCAGGGACTTGGGCCA
CAGCCCACAGGCTTTGGTGGATATGGGCAATTCCAACAACCAATGCAGACTGGTATCAACTCTGTCCTTCCCCCT
GCACTGCAACCGCAACCCACTGGTGTCAATGGCTACGGCAACCAGTCCTACACATCTCCGCCTCCTGTGCCGCCA
ATTCCCCAGCAACCAACAGCGACCCCCCTGTCACCACAGAAGACCGGACCGGCTCCCCCCATCAGATTTGGTGTC
AAGCCAGATGGTCCCAAGAAGCTTGAGCCACAACCGACTGGACTCAGAGCCAACCTTTCGCAAGCTAGTAAGTTT
TTCTTACCATTAAAGGTGGTAAACTTGAACAGAAACTAACTCAATTTACAGCCCCCAATAATCCGTTCGGCTTCT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail