Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8474.t1
Gene name
Locationscaffold_33:172109..173231
Strand-
Gene length (bp)1122
Transcript length (bp)1122
Coding sequence length (bp)1122
Protein length (aa) 374

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02678 Pirin Pirin 1.8E-30 94 192
PF05726 Pirin_C Pirin C-terminal cupin domain 7.8E-24 249 356

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 38.24 20.69 55.78
5d_25C Five days - 25 degrees Celsius 36.39 19.54 53.23
7d_25C Seven days - 25 degrees Celsius 41.34 22.58 60.09
10d_25C Ten days - 25 degrees Celsius 186.52 78.10 294.94
7d_15C Seven days - 15 degrees Celsius 40.91 22.50 59.31
7d_30C Seven days - 30 degrees Celsius 33.23 17.45 49.02

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.901593 no
3d_25C 7d_25C 0.826364 no
3d_25C 7d_15C 0.856287 no
3d_25C 7d_30C 0.673405 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.691819 no
5d_25C 7d_15C 0.725145 no
5d_25C 7d_30C 0.797823 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.981601 no
7d_25C 7d_30C 0.453041 no
7d_25C 10d_25C 0.000700 yes
7d_15C 7d_30C 0.484599 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8474.t1
MKLLLPLLICITAIFLAYNPSIKDSLKDSLVSFIQQQAPSLSEHLQTKNIVNQTNHHLNLETPTPTVFPITDMSV
PRAIRQAFLAIEQAEGAGARVRRSIGTAKLRNFSPFLMLDHFTIGKGAGFPDHPHRGQETITYLLSGGVDHEDFA
GNKGTIGPGDLQFMTAGRGIMHAEMPHENEDGSPNVGMQLWVDLPQKLKFCEPRYRDLRAEEIPLATVDEGRVKI
KVISGQSHGVDSVRDLAYTPVWILDITIKPGGRISQPLPQGWNSFAYTLAGETVFGSNDSTRIVKEFTNVQFEQT
GDFVELSVPDNAEKDARIFLVAGQPLDQKVVQYGPFVLNTQDEVYQAMLDYQTASNGFERSRNWQSEIGKRMG*
Coding >Pro_DTO377G3_2|g8474.t1
ATGAAACTACTTCTGCCACTTTTAATTTGTATCACAGCAATCTTCCTTGCCTATAACCCTTCTATCAAAGACTCT
CTCAAGGACTCTTTGGTCTCATTTATCCAGCAACAAGCTCCTAGCCTGTCAGAGCACCTTCAGACCAAAAACATT
GTCAATCAGACAAACCACCACCTGAACCTGGAAACCCCGACGCCCACAGTCTTCCCCATCACAGACATGTCCGTC
CCTCGCGCTATCCGACAGGCATTCCTTGCCATCGAGCAAGCAGAAGGCGCAGGTGCCCGTGTGCGCCGCTCTATC
GGAACTGCCAAGCTCCGCAACTTCAGTCCCTTCCTCATGCTTGACCACTTCACGATCGGTAAGGGCGCTGGCTTC
CCAGACCACCCTCACCGCGGTCAAGAGACCATCACCTATTTGTTGTCCGGCGGCGTTGACCATGAAGACTTTGCC
GGTAACAAGGGAACTATCGGACCCGGCGATCTGCAATTCATGACCGCAGGCCGCGGTATCATGCATGCTGAGATG
CCCCACGAGAACGAAGACGGTAGCCCAAATGTCGGTATGCAGTTGTGGGTCGATCTGCCCCAGAAGCTGAAATTC
TGTGAGCCTCGTTACCGTGATCTTCGCGCTGAGGAGATTCCCCTCGCGACAGTCGATGAGGGCCGCGTCAAGATC
AAGGTCATCTCGGGCCAGTCGCACGGTGTTGACTCCGTGCGTGACTTGGCCTACACCCCTGTCTGGATCTTGGAT
ATCACGATCAAGCCCGGTGGTCGTATATCGCAGCCCCTACCACAGGGATGGAACTCATTTGCTTACACCTTGGCT
GGTGAGACTGTCTTTGGCTCGAATGATTCCACTCGCATCGTGAAGGAATTCACAAACGTTCAATTCGAGCAGACT
GGTGACTTTGTTGAACTCTCTGTCCCGGATAACGCCGAGAAGGATGCCCGCATTTTCCTTGTGGCTGGTCAGCCA
CTGGACCAGAAGGTTGTTCAGTATGGACCTTTTGTACTGAACACTCAGGATGAGGTTTACCAGGCGATGCTCGAC
TACCAGACCGCCTCCAATGGATTTGAGAGGTCTCGAAACTGGCAGAGTGAGATTGGCAAGAGAATGGGATAA
Transcript >Pro_DTO377G3_2|g8474.t1
ATGAAACTACTTCTGCCACTTTTAATTTGTATCACAGCAATCTTCCTTGCCTATAACCCTTCTATCAAAGACTCT
CTCAAGGACTCTTTGGTCTCATTTATCCAGCAACAAGCTCCTAGCCTGTCAGAGCACCTTCAGACCAAAAACATT
GTCAATCAGACAAACCACCACCTGAACCTGGAAACCCCGACGCCCACAGTCTTCCCCATCACAGACATGTCCGTC
CCTCGCGCTATCCGACAGGCATTCCTTGCCATCGAGCAAGCAGAAGGCGCAGGTGCCCGTGTGCGCCGCTCTATC
GGAACTGCCAAGCTCCGCAACTTCAGTCCCTTCCTCATGCTTGACCACTTCACGATCGGTAAGGGCGCTGGCTTC
CCAGACCACCCTCACCGCGGTCAAGAGACCATCACCTATTTGTTGTCCGGCGGCGTTGACCATGAAGACTTTGCC
GGTAACAAGGGAACTATCGGACCCGGCGATCTGCAATTCATGACCGCAGGCCGCGGTATCATGCATGCTGAGATG
CCCCACGAGAACGAAGACGGTAGCCCAAATGTCGGTATGCAGTTGTGGGTCGATCTGCCCCAGAAGCTGAAATTC
TGTGAGCCTCGTTACCGTGATCTTCGCGCTGAGGAGATTCCCCTCGCGACAGTCGATGAGGGCCGCGTCAAGATC
AAGGTCATCTCGGGCCAGTCGCACGGTGTTGACTCCGTGCGTGACTTGGCCTACACCCCTGTCTGGATCTTGGAT
ATCACGATCAAGCCCGGTGGTCGTATATCGCAGCCCCTACCACAGGGATGGAACTCATTTGCTTACACCTTGGCT
GGTGAGACTGTCTTTGGCTCGAATGATTCCACTCGCATCGTGAAGGAATTCACAAACGTTCAATTCGAGCAGACT
GGTGACTTTGTTGAACTCTCTGTCCCGGATAACGCCGAGAAGGATGCCCGCATTTTCCTTGTGGCTGGTCAGCCA
CTGGACCAGAAGGTTGTTCAGTATGGACCTTTTGTACTGAACACTCAGGATGAGGTTTACCAGGCGATGCTCGAC
TACCAGACCGCCTCCAATGGATTTGAGAGGTCTCGAAACTGGCAGAGTGAGATTGGCAAGAGAATGGGATAA
Gene >Pro_DTO377G3_2|g8474.t1
ATGAAACTACTTCTGCCACTTTTAATTTGTATCACAGCAATCTTCCTTGCCTATAACCCTTCTATCAAAGACTCT
CTCAAGGACTCTTTGGTCTCATTTATCCAGCAACAAGCTCCTAGCCTGTCAGAGCACCTTCAGACCAAAAACATT
GTCAATCAGACAAACCACCACCTGAACCTGGAAACCCCGACGCCCACAGTCTTCCCCATCACAGACATGTCCGTC
CCTCGCGCTATCCGACAGGCATTCCTTGCCATCGAGCAAGCAGAAGGCGCAGGTGCCCGTGTGCGCCGCTCTATC
GGAACTGCCAAGCTCCGCAACTTCAGTCCCTTCCTCATGCTTGACCACTTCACGATCGGTAAGGGCGCTGGCTTC
CCAGACCACCCTCACCGCGGTCAAGAGACCATCACCTATTTGTTGTCCGGCGGCGTTGACCATGAAGACTTTGCC
GGTAACAAGGGAACTATCGGACCCGGCGATCTGCAATTCATGACCGCAGGCCGCGGTATCATGCATGCTGAGATG
CCCCACGAGAACGAAGACGGTAGCCCAAATGTCGGTATGCAGTTGTGGGTCGATCTGCCCCAGAAGCTGAAATTC
TGTGAGCCTCGTTACCGTGATCTTCGCGCTGAGGAGATTCCCCTCGCGACAGTCGATGAGGGCCGCGTCAAGATC
AAGGTCATCTCGGGCCAGTCGCACGGTGTTGACTCCGTGCGTGACTTGGCCTACACCCCTGTCTGGATCTTGGAT
ATCACGATCAAGCCCGGTGGTCGTATATCGCAGCCCCTACCACAGGGATGGAACTCATTTGCTTACACCTTGGCT
GGTGAGACTGTCTTTGGCTCGAATGATTCCACTCGCATCGTGAAGGAATTCACAAACGTTCAATTCGAGCAGACT
GGTGACTTTGTTGAACTCTCTGTCCCGGATAACGCCGAGAAGGATGCCCGCATTTTCCTTGTGGCTGGTCAGCCA
CTGGACCAGAAGGTTGTTCAGTATGGACCTTTTGTACTGAACACTCAGGATGAGGTTTACCAGGCGATGCTCGAC
TACCAGACCGCCTCCAATGGATTTGAGAGGTCTCGAAACTGGCAGAGTGAGATTGGCAAGAGAATGGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail