Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8470.t1
Gene name
Locationscaffold_33:159367..162959
Strand-
Gene length (bp)3592
Transcript length (bp)3426
Coding sequence length (bp)3426
Protein length (aa) 1142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01412 ArfGap Putative GTPase activating protein for Arf 7.2E-34 840 952
PF16746 BAR_3 BAR domain of APPL family 4.1E-21 307 538
PF00169 PH PH domain 8.4E-12 671 757

GO

GO Term Description Terminal node
GO:0005096 GTPase activator activity Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0008047 enzyme activator activity No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8470.t1
MGNVATRLDDAGNLFFKDQNRFAIASVTISNSRRRLLTLSPNAFPAARFVAKRDAGDDTPIEYIQDPDTPSTAPI
PTFMLRLSNDEELIFKFTFIIRQMKTGNAPNSVNGVSTTMPEVADTSLTGLTFAHASNSKELDNLITREFHANPN
LQNNSNVQLIGDYSTGGTPSVSFEWSWRWKPPKVTEDKGGGWRNSCSFLDYDQRTNRLNTLAHFSFWVHNSLRPP
PSPQISSPHLELPVFPRSRISSTQSVISHYSDAESTVNPSITPPEPVEKSLPPPPPPSAPPPPPPAKVDLPHSRA
GDEMSGVEDGPLFRATMKALESKTSNMRTKIKKVLKKAESAQLAQANCNEAMEQFLTSLNDASTSNANAIQPALD
HYFEKIARQILNYEQLNTVQLQKLVIDPLVKLYNNDIKQAEAKKKDWDEESRDYYAYVSRYLGQRQDSLKEKKRA
ESDSKYQAKRRNFELRRFDYSSFMQDLHGGRKEQEVLSHLTKYASCQAKNFLSAAKKVEGMTPQLEALIHEVDQA
DKEFQFQRTEREEKRRALENGSNPYLEPDVVVGTTSVPPIPPGTANSGPSTEVELGRADSTGSQLRGVISNTSSI
SSQANAGPAAPATGISAPASNSTVAANVGQNRFKGIRDLEEHNSGSDRTSSQQRKEGLLWALSRPGSHIDPKGIN
KQAWHKFWIVLDQGKLSEYSNWKQKLDLHMDPIDLRMASVREARNAERRFCFEVITPQFKRIYQATSEDDMSNWI
RAINNALQSAVEGQETPPPSASRNDRPTSRDIGSALTGKSSSVSGHHSHSSSSSASNAGVIRRTTVGARPSYVRP
DSNFEENPAKLLQVVRDADQGNNWCADCGSSSKVEWVSINLGIILCIECSGIHRSLGTHISKIRSLTLDVHSFSN
DIVEILLQIGNRVSNMIWEATLDQTLKPSASSTREQRLKFITAKYVDRAYVENLPSPRSRFATADETLLASIKQN
DIQGVLYGLALGGNVNITDRSRNTHATFLALAAADPASPGAPPTTLAARSSAKAIPFPIAELLVQNGAEIPPQPP
SIPLSPAAKLYLSQRTARTSAFSVPPPPLGGKSYANDTLGSLPTIRSKESSSSSNASTVTDSRDKDREKLSKRGS
AGARFAGKVASLGIDR*
Coding >Pro_DTO377G3_2|g8470.t1
ATGGGGAATGTTGCCACCCGCCTTGACGATGCGGGGAACTTGTTTTTCAAGGATCAGAATCGTTTCGCGATCGCA
TCGGTCACGATAAGCAACTCACGACGTCGTCTTTTGACTCTATCCCCCAACGCGTTCCCGGCGGCAAGGTTCGTA
GCCAAGCGCGATGCTGGCGACGATACTCCGATCGAATATATTCAGGACCCCGACACCCCCTCCACCGCTCCGATC
CCGACCTTCATGCTACGCCTGTCGAACGACGAGGAGCTGATCTTCAAGTTTACCTTTATCATTCGTCAGATGAAG
ACTGGCAATGCTCCAAACTCTGTCAACGGTGTTTCAACGACTATGCCCGAGGTGGCAGACACTAGTCTCACGGGA
CTCACGTTCGCTCACGCATCCAACTCGAAGGAACTGGATAATCTGATCACAAGAGAGTTCCATGCGAACCCTAAC
CTTCAGAATAACTCTAATGTTCAACTGATTGGAGATTACTCCACTGGGGGTACCCCGTCCGTGTCGTTCGAATGG
TCATGGCGATGGAAGCCTCCGAAGGTAACAGAGGACAAAGGTGGCGGTTGGCGCAACAGCTGCAGCTTCTTGGAT
TACGATCAAAGAACAAACCGCCTTAACACTCTCGCCCATTTTTCCTTCTGGGTGCACAACTCCTTGCGTCCTCCG
CCGAGCCCTCAGATCTCATCGCCACACCTGGAGTTACCCGTCTTTCCGCGCTCTCGGATTTCATCGACTCAATCC
GTTATATCTCACTATAGCGATGCCGAATCGACCGTTAATCCATCCATCACTCCACCTGAGCCAGTGGAGAAGTCT
CTCCCACCTCCTCCCCCGCCGTCCGCGCCTCCTCCCCCACCACCAGCCAAGGTAGATCTCCCACATTCGCGGGCA
GGTGATGAGATGAGCGGAGTGGAGGATGGACCATTGTTCCGGGCGACTATGAAAGCGCTAGAGTCGAAGACAAGC
AACATGCGAACCAAAATCAAGAAGGTGCTCAAGAAAGCCGAGAGCGCGCAGCTAGCGCAAGCCAATTGCAATGAG
GCCATGGAACAGTTCCTAACGTCATTGAATGATGCGTCTACGTCTAATGCAAATGCTATTCAGCCCGCGTTAGAT
CATTACTTCGAGAAAATTGCTCGGCAAATTCTGAACTACGAGCAGCTCAACACGGTGCAACTTCAGAAACTGGTG
ATTGATCCTCTGGTCAAACTATACAACAACGATATTAAGCAAGCAGAAGCCAAAAAGAAGGACTGGGATGAAGAG
AGCCGCGACTATTACGCTTATGTCAGTCGGTATTTGGGCCAGCGACAGGATTCGCTGAAAGAGAAGAAGCGTGCC
GAGAGCGATTCGAAGTATCAAGCCAAGCGGCGAAATTTCGAACTGAGGCGATTTGATTACTCCTCCTTTATGCAA
GATCTCCATGGAGGTCGCAAAGAGCAAGAGGTTCTCTCACATCTCACCAAATATGCGAGTTGCCAGGCCAAGAAT
TTCCTGTCAGCCGCCAAAAAGGTTGAAGGAATGACCCCTCAGCTGGAAGCTCTTATTCACGAGGTGGACCAGGCC
GACAAGGAGTTCCAATTCCAGCGCACAGAGCGCGAAGAGAAGCGCCGGGCTCTGGAGAATGGCAGTAACCCATAT
CTTGAGCCCGACGTAGTGGTTGGTACAACTAGTGTGCCTCCTATCCCTCCTGGGACTGCCAATAGCGGCCCTTCT
ACCGAGGTGGAGCTTGGTAGGGCTGATAGCACAGGCTCTCAGCTTCGAGGAGTCATTAGCAACACCTCATCGATT
TCGTCTCAAGCAAATGCAGGACCGGCCGCACCAGCTACAGGAATCAGTGCACCCGCGTCAAACTCGACGGTGGCT
GCTAATGTGGGCCAGAATCGCTTCAAGGGTATCCGGGATCTCGAGGAGCACAACAGCGGATCTGATCGGACAAGT
AGCCAACAGCGCAAAGAAGGCCTTTTGTGGGCACTGTCACGTCCAGGATCTCACATCGATCCGAAGGGTATCAAC
AAGCAAGCATGGCACAAATTTTGGATTGTTTTGGATCAAGGGAAATTATCCGAGTATAGCAACTGGAAACAAAAG
CTGGATCTACACATGGACCCCATCGATCTGCGCATGGCATCAGTCCGTGAAGCTCGAAACGCGGAACGACGGTTC
TGTTTCGAAGTGATCACACCCCAGTTCAAACGTATTTACCAAGCGACATCCGAGGACGACATGTCCAATTGGATC
AGGGCTATCAACAACGCGCTGCAGAGTGCGGTTGAAGGCCAGGAGACTCCGCCTCCCTCCGCATCTAGGAATGAT
AGACCTACCAGTCGGGATATTGGTTCCGCCCTAACAGGGAAAAGCTCGTCTGTGTCTGGTCACCACTCCCATTCC
TCCTCTAGCTCAGCCAGCAACGCTGGCGTCATCCGCCGAACAACCGTCGGTGCGCGCCCAAGCTATGTCCGTCCT
GATAGCAACTTTGAAGAGAATCCTGCAAAGCTTCTGCAGGTTGTACGGGATGCGGATCAAGGCAACAACTGGTGT
GCTGATTGCGGATCATCATCCAAAGTTGAATGGGTCTCCATCAACCTTGGAATCATTCTCTGCATTGAATGTAGT
GGAATCCACCGCTCTCTGGGCACGCATATATCCAAGATTCGCTCTCTCACATTGGATGTACATTCCTTCTCGAAT
GATATCGTCGAGATTCTCCTGCAGATTGGCAACCGCGTTAGCAACATGATTTGGGAGGCGACCTTGGATCAAACT
CTCAAGCCGAGCGCCAGTTCTACACGAGAGCAACGGTTGAAATTCATCACCGCCAAATATGTTGATCGAGCCTAC
GTTGAGAATCTGCCTTCACCACGTTCTCGCTTCGCGACGGCCGACGAAACGCTCCTCGCGTCAATCAAACAGAAC
GACATCCAAGGCGTCCTCTACGGTCTCGCCCTGGGTGGCAACGTAAATATAACCGATCGCTCTCGCAACACTCAC
GCAACCTTCCTAGCCCTTGCCGCAGCCGATCCTGCGTCCCCAGGCGCCCCACCAACCACTCTTGCCGCGAGATCT
AGCGCAAAAGCCATCCCATTCCCTATCGCCGAGCTGTTAGTCCAAAACGGCGCTGAGATCCCGCCACAACCTCCT
TCCATTCCTCTCTCCCCCGCAGCCAAGCTGTATCTCAGCCAACGGACCGCCCGCACATCTGCCTTCAGCGTGCCT
CCACCGCCGCTAGGTGGAAAGTCCTACGCAAACGATACCCTGGGCTCTCTCCCAACTATCCGCAGCAAGGAGTCT
TCCTCTTCGTCAAACGCTTCAACTGTCACAGACAGCAGAGACAAAGACAGAGAGAAGCTCTCCAAAAGAGGAAGC
GCTGGCGCTCGCTTTGCGGGAAAAGTGGCTTCACTTGGAATTGATCGATAA
Transcript >Pro_DTO377G3_2|g8470.t1
ATGGGGAATGTTGCCACCCGCCTTGACGATGCGGGGAACTTGTTTTTCAAGGATCAGAATCGTTTCGCGATCGCA
TCGGTCACGATAAGCAACTCACGACGTCGTCTTTTGACTCTATCCCCCAACGCGTTCCCGGCGGCAAGGTTCGTA
GCCAAGCGCGATGCTGGCGACGATACTCCGATCGAATATATTCAGGACCCCGACACCCCCTCCACCGCTCCGATC
CCGACCTTCATGCTACGCCTGTCGAACGACGAGGAGCTGATCTTCAAGTTTACCTTTATCATTCGTCAGATGAAG
ACTGGCAATGCTCCAAACTCTGTCAACGGTGTTTCAACGACTATGCCCGAGGTGGCAGACACTAGTCTCACGGGA
CTCACGTTCGCTCACGCATCCAACTCGAAGGAACTGGATAATCTGATCACAAGAGAGTTCCATGCGAACCCTAAC
CTTCAGAATAACTCTAATGTTCAACTGATTGGAGATTACTCCACTGGGGGTACCCCGTCCGTGTCGTTCGAATGG
TCATGGCGATGGAAGCCTCCGAAGGTAACAGAGGACAAAGGTGGCGGTTGGCGCAACAGCTGCAGCTTCTTGGAT
TACGATCAAAGAACAAACCGCCTTAACACTCTCGCCCATTTTTCCTTCTGGGTGCACAACTCCTTGCGTCCTCCG
CCGAGCCCTCAGATCTCATCGCCACACCTGGAGTTACCCGTCTTTCCGCGCTCTCGGATTTCATCGACTCAATCC
GTTATATCTCACTATAGCGATGCCGAATCGACCGTTAATCCATCCATCACTCCACCTGAGCCAGTGGAGAAGTCT
CTCCCACCTCCTCCCCCGCCGTCCGCGCCTCCTCCCCCACCACCAGCCAAGGTAGATCTCCCACATTCGCGGGCA
GGTGATGAGATGAGCGGAGTGGAGGATGGACCATTGTTCCGGGCGACTATGAAAGCGCTAGAGTCGAAGACAAGC
AACATGCGAACCAAAATCAAGAAGGTGCTCAAGAAAGCCGAGAGCGCGCAGCTAGCGCAAGCCAATTGCAATGAG
GCCATGGAACAGTTCCTAACGTCATTGAATGATGCGTCTACGTCTAATGCAAATGCTATTCAGCCCGCGTTAGAT
CATTACTTCGAGAAAATTGCTCGGCAAATTCTGAACTACGAGCAGCTCAACACGGTGCAACTTCAGAAACTGGTG
ATTGATCCTCTGGTCAAACTATACAACAACGATATTAAGCAAGCAGAAGCCAAAAAGAAGGACTGGGATGAAGAG
AGCCGCGACTATTACGCTTATGTCAGTCGGTATTTGGGCCAGCGACAGGATTCGCTGAAAGAGAAGAAGCGTGCC
GAGAGCGATTCGAAGTATCAAGCCAAGCGGCGAAATTTCGAACTGAGGCGATTTGATTACTCCTCCTTTATGCAA
GATCTCCATGGAGGTCGCAAAGAGCAAGAGGTTCTCTCACATCTCACCAAATATGCGAGTTGCCAGGCCAAGAAT
TTCCTGTCAGCCGCCAAAAAGGTTGAAGGAATGACCCCTCAGCTGGAAGCTCTTATTCACGAGGTGGACCAGGCC
GACAAGGAGTTCCAATTCCAGCGCACAGAGCGCGAAGAGAAGCGCCGGGCTCTGGAGAATGGCAGTAACCCATAT
CTTGAGCCCGACGTAGTGGTTGGTACAACTAGTGTGCCTCCTATCCCTCCTGGGACTGCCAATAGCGGCCCTTCT
ACCGAGGTGGAGCTTGGTAGGGCTGATAGCACAGGCTCTCAGCTTCGAGGAGTCATTAGCAACACCTCATCGATT
TCGTCTCAAGCAAATGCAGGACCGGCCGCACCAGCTACAGGAATCAGTGCACCCGCGTCAAACTCGACGGTGGCT
GCTAATGTGGGCCAGAATCGCTTCAAGGGTATCCGGGATCTCGAGGAGCACAACAGCGGATCTGATCGGACAAGT
AGCCAACAGCGCAAAGAAGGCCTTTTGTGGGCACTGTCACGTCCAGGATCTCACATCGATCCGAAGGGTATCAAC
AAGCAAGCATGGCACAAATTTTGGATTGTTTTGGATCAAGGGAAATTATCCGAGTATAGCAACTGGAAACAAAAG
CTGGATCTACACATGGACCCCATCGATCTGCGCATGGCATCAGTCCGTGAAGCTCGAAACGCGGAACGACGGTTC
TGTTTCGAAGTGATCACACCCCAGTTCAAACGTATTTACCAAGCGACATCCGAGGACGACATGTCCAATTGGATC
AGGGCTATCAACAACGCGCTGCAGAGTGCGGTTGAAGGCCAGGAGACTCCGCCTCCCTCCGCATCTAGGAATGAT
AGACCTACCAGTCGGGATATTGGTTCCGCCCTAACAGGGAAAAGCTCGTCTGTGTCTGGTCACCACTCCCATTCC
TCCTCTAGCTCAGCCAGCAACGCTGGCGTCATCCGCCGAACAACCGTCGGTGCGCGCCCAAGCTATGTCCGTCCT
GATAGCAACTTTGAAGAGAATCCTGCAAAGCTTCTGCAGGTTGTACGGGATGCGGATCAAGGCAACAACTGGTGT
GCTGATTGCGGATCATCATCCAAAGTTGAATGGGTCTCCATCAACCTTGGAATCATTCTCTGCATTGAATGTAGT
GGAATCCACCGCTCTCTGGGCACGCATATATCCAAGATTCGCTCTCTCACATTGGATGTACATTCCTTCTCGAAT
GATATCGTCGAGATTCTCCTGCAGATTGGCAACCGCGTTAGCAACATGATTTGGGAGGCGACCTTGGATCAAACT
CTCAAGCCGAGCGCCAGTTCTACACGAGAGCAACGGTTGAAATTCATCACCGCCAAATATGTTGATCGAGCCTAC
GTTGAGAATCTGCCTTCACCACGTTCTCGCTTCGCGACGGCCGACGAAACGCTCCTCGCGTCAATCAAACAGAAC
GACATCCAAGGCGTCCTCTACGGTCTCGCCCTGGGTGGCAACGTAAATATAACCGATCGCTCTCGCAACACTCAC
GCAACCTTCCTAGCCCTTGCCGCAGCCGATCCTGCGTCCCCAGGCGCCCCACCAACCACTCTTGCCGCGAGATCT
AGCGCAAAAGCCATCCCATTCCCTATCGCCGAGCTGTTAGTCCAAAACGGCGCTGAGATCCCGCCACAACCTCCT
TCCATTCCTCTCTCCCCCGCAGCCAAGCTGTATCTCAGCCAACGGACCGCCCGCACATCTGCCTTCAGCGTGCCT
CCACCGCCGCTAGGTGGAAAGTCCTACGCAAACGATACCCTGGGCTCTCTCCCAACTATCCGCAGCAAGGAGTCT
TCCTCTTCGTCAAACGCTTCAACTGTCACAGACAGCAGAGACAAAGACAGAGAGAAGCTCTCCAAAAGAGGAAGC
GCTGGCGCTCGCTTTGCGGGAAAAGTGGCTTCACTTGGAATTGATCGATAA
Gene >Pro_DTO377G3_2|g8470.t1
ATGGGGAATGTTGCCACCCGCCTTGACGATGCGGGGAACTTGTTTTTCAAGGATCAGAATCGTTGTGGGTTAAAA
TACCGGATCTGAACCTCTTGTCGATATGCTGATGAAATTTCAATAGTCGCGATCGCATCGGTCACGATAAGCAAC
TCACGACGTCGTCTTTTGACTCTATCCCCCAACGCGTTCCCGGCGGCAAGGTTCGTAGCCAAGCGCGATGCTGGC
GACGATACTCCGATCGAATATATTCAGGTACGCGGTACCTAATATCATGTATCGGGTCTTCTAGCTAACAAGTCC
CCTCAAACCGAACAGGACCCCGACACCCCCTCCACCGCTCCGATCCCGACCTTCATGCTACGCCTGTCGAACGAC
GAGGAGCTGATCTTCAAGTTTACCTTTATCATTCGTCAGATGAAGACTGGCAATGCTCCAAACTCTGTCAACGGT
GTTTCAACGACTATGCCCGAGGTGGCAGACACTAGTCTCACGGGACTCACGTTCGCTCACGCATCCAACTCGAAG
GAACTGGATAATCTGATCACAAGAGAGTTCCATGCGAACCCTAACCTTCAGAATAACTCTAATGTTCAACTGATT
GGAGATTACTCCACTGGGGGTACCCCGTCCGTGTCGTTCGAATGGTCATGGCGATGGAAGCCTCCGAAGGTAACA
GAGGACAAAGGTGGCGGTTGGCGCAACAGCTGCAGCTTCTTGGATTACGATCAAAGAACAAACCGCCTTAACACT
CTCGCCCATTTTTCCTTCTGGGTGCACAACTCCTTGCGTCCTCCGCCGAGCCCTCAGATCTCATCGCCACACCTG
GAGTTACCCGTCTTTCCGCGCTCTCGGATTTCATCGACTCAATCCGTTATATCTCACTATAGCGATGCCGAATCG
ACCGTTAATCCATCCATCACTCCACCTGAGCCAGTGGAGAAGTCTCTCCCACCTCCTCCCCCGCCGTCCGCGCCT
CCTCCCCCACCACCAGCCAAGGTAGATCTCCCACATTCGCGGGCAGGTGATGAGATGAGCGGAGTGGAGGATGGA
CCATTGTTCCGGGCGACTATGAAAGCGCTAGAGTCGAAGACAAGCAACATGCGAACCAAAATCAAGAAGGTGCTC
AAGAAAGCCGAGAGCGCGCAGCTAGCGCAAGCCAATTGCAATGAGGCCATGGAACAGTTCCTAACGTCATTGAAT
GATGCGTCTACGTCTAATGCAAATGCTATTCAGCCCGCGTTAGATCATTACTTCGAGAAAATTGCTCGGCAAATT
CTGAACTACGAGCAGCTCAACACGGTGCAACTTCAGAAACTGGTGATTGATCCTCTGGTCAAACTATACAACAAC
GATATTAAGCAAGCAGAAGCCAAAAAGAAGGACTGGGATGAAGAGAGCCGCGACTATTACGCTTATGTCAGTCGG
TATTTGGGCCAGCGACAGGATTCGCTGAAAGAGAAGAAGCGTGCCGAGAGCGATTCGAAGTATCAAGCCAAGCGG
CGAAATTTCGAACTGAGGCGATTTGATTACTCCTCCTTTATGCAAGATCTCCATGGAGGTCGCAAAGAGCAAGAG
GTTCTCTCACATCTCACCAAATATGCGAGTTGCCAGGCCAAGAATTTCCTGTCAGCCGCCAAAAAGGTTGAAGGA
ATGACCCCTCAGCTGGAAGCTCTTATTCACGAGGTGGACCAGGCCGACAAGGAGTTCCAATTCCAGCGCACAGAG
CGCGAAGAGAAGCGCCGGGCTCTGGAGAATGGCAGTAACCCATATCTTGAGCCCGACGTAGTGGTTGGTACAACT
AGTGTGCCTCCTATCCCTCCTGGGACTGCCAATAGCGGCCCTTCTACCGAGGTGGAGCTTGGTAGGGCTGATAGC
ACAGGCTCTCAGCTTCGAGGAGTCATTAGCAACACCTCATCGATTTCGTCTCAAGCAAATGCAGGACCGGCCGCA
CCAGCTACAGGAATCAGTGCACCCGCGTCAAACTCGACGGTGGCTGCTAATGTGGGCCAGAATCGCTTCAAGGGT
ATCCGGGATCTCGAGGAGCACAACAGCGGATCTGATCGGACAAGTAGCCAACAGCGCAAAGAAGGCCTTTTGTGG
GCACTGTCACGTCCAGGATCTCACATCGATCCGAAGGGTATCAACAAGCAAGCATGGCACAAGTAAGTACAAGCG
CAGGAATGGTTGTACAACTTCTAATTTTATCAGATTTTGGATTGTTTTGGATCAAGGGAAATTATCCGAGTATAG
CAACTGGAAACAAAAGCTGGATCTACACATGGACCCCATCGATCTGCGCATGGCATCAGTCCGTGAAGCTCGAAA
CGCGGAACGACGGTTCTGTTTCGAAGTGATCACACCCCAGTTCAAACGTATTTACCAAGCGACATCCGAGGACGA
CATGTCCAATTGGATCAGGGCTATCAACAACGCGCTGCAGAGTGCGGTTGAAGGCCAGGAGACTCCGCCTCCCTC
CGCATCTAGGAATGATAGACCTACCAGTCGGGATATTGGTTCCGCCCTAACAGGGAAAAGCTCGTCTGTGTCTGG
TCACCACTCCCATTCCTCCTCTAGCTCAGCCAGCAACGCTGGCGTCATCCGCCGAACAACCGTCGGTGCGCGCCC
AAGCTATGTCCGTCCTGATAGCAACTTTGAAGAGAATCCTGCAAAGCTTCTGCAGGTTGTACGGGATGCGGATCA
AGGCAACAACTGGTGTGCTGATTGCGGATCATCATCCAAAGTTGAATGGGTCTCCATCAACCTTGGAATCATTCT
CTGCATTGAATGTAGTGGAATCCACCGCTCTCTGGGCACGCATATATCCAAGATTCGCTCTCTCACATTGGATGT
ACATTCCTTCTCGAATGATATCGTCGAGATTCTCCTGCAGATTGGCAACCGCGTTAGCAACATGATTTGGGAGGC
GACCTTGGATCAAACTCTCAAGCCGAGCGCCAGTTCTACACGAGAGCAACGGTTGAAATTCATCACCGCCAAATA
TGTTGATCGAGCCTACGTTGAGAATCTGCCTTCACCACGTTCTCGCTTCGCGACGGCCGACGAAACGCTCCTCGC
GTCAATCAAACAGAACGACATCCAAGGCGTCCTCTACGGTCTCGCCCTGGGTGGCAACGTAAATATAACCGATCG
CTCTCGCAACACTCACGCAACCTTCCTAGCCCTTGCCGCAGCCGATCCTGCGTCCCCAGGCGCCCCACCAACCAC
TCTTGCCGCGAGATCTAGCGCAAAAGCCATCCCATTCCCTATCGCCGAGCTGTTAGTCCAAAACGGCGCTGAGAT
CCCGCCACAACCTCCTTCCATTCCTCTCTCCCCCGCAGCCAAGCTGTATCTCAGCCAACGGACCGCCCGCACATC
TGCCTTCAGCGTGCCTCCACCGCCGCTAGGTGGAAAGTCCTACGCAAACGATACCCTGGGCTCTCTCCCAACTAT
CCGCAGCAAGGAGTCTTCCTCTTCGTCAAACGCTTCAACTGTCACAGACAGCAGAGACAAAGACAGAGAGAAGCT
CTCCAAAAGAGGAAGCGCTGGCGCTCGCTTTGCGGGAAAAGTGGCTTCACTTGGAATTGATCGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail