Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8464.t1
Gene name
Locationscaffold_33:138032..139778
Strand-
Gene length (bp)1746
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 1.9E-77 55 500

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0046914 transition metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 54 76 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 82.15 50.03 114.27
5d_25C Five days - 25 degrees Celsius 84.44 51.88 117.00
7d_25C Seven days - 25 degrees Celsius 101.82 62.52 141.12
10d_25C Ten days - 25 degrees Celsius 118.20 72.07 164.32
7d_15C Seven days - 15 degrees Celsius 70.96 43.16 98.76
7d_30C Seven days - 30 degrees Celsius 84.11 51.48 116.74

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.934325 no
3d_25C 7d_25C 0.367713 no
3d_25C 7d_15C 0.590208 no
3d_25C 7d_30C 0.942122 no
3d_25C 10d_25C 0.092370 no
5d_25C 7d_25C 0.438835 no
5d_25C 7d_15C 0.489347 no
5d_25C 7d_30C 0.991203 no
5d_25C 10d_25C 0.123662 no
7d_25C 7d_15C 0.096602 no
7d_25C 7d_30C 0.426357 no
7d_25C 10d_25C 0.559331 no
7d_15C 7d_30C 0.505472 no
7d_15C 10d_25C 0.014096 yes
7d_30C 10d_25C 0.112992 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8464.t1
MGLFATFLATFCEHCSTQSIYTLASVGALSFVALSIVINVLCQLFFKKSHEPPVVFHWVPFIGSTISYGMNPYNF
FDQARAKYGDIFTFVLLGKKTTVYLGTKGNEFILNGKLRDVNAEEVYSPLTTPVFGRHVVYDCPNAKLMEQKKFV
KFGLTSEALRSYVHLITNEVDDFVKNSSAFKDPKGTFNVSKVIAEITIYTASRSLQGQEVRDRFDSTFAEMYHDL
DKGFAPINFMLPWAPLPHNRKRDAAQKKMTETYMDIIKARRAAGDKKDSEDMVWNLMSCTYKNGNPIPDEEIAHM
MIALLMAGQHSSSSTAAWIVLRLASCPEIVEELYQEQLQVLGSDLPPLTHEALQKLDLHAKVIKETLRIHAPIHS
IIRAVKNPMPVEGTSYVIPTTHNVLSSPGVTARSPEFFPEPLKWNPHRWDEASTENTKDEDEEQIDYGYGLVTKG
TNSPYLPFGAGRHRCIGEQFAYVQLGTILAALVRHFKFSTPIAGTPFPETDYSSLFSKPLGTSFVQYERRGVKA*
Coding >Pro_DTO377G3_2|g8464.t1
ATGGGCCTCTTCGCAACTTTCCTCGCCACTTTCTGCGAGCACTGCTCGACCCAGTCAATCTACACTTTGGCCAGC
GTCGGGGCACTGTCATTCGTTGCGCTATCGATTGTGATCAATGTGCTGTGCCAGCTCTTCTTCAAGAAATCCCAT
GAGCCCCCCGTGGTCTTCCACTGGGTCCCCTTTATTGGAAGCACCATCAGCTATGGCATGAACCCATACAACTTC
TTCGACCAAGCTCGCGCAAAGTATGGCGACATCTTCACCTTTGTCCTCCTGGGCAAGAAAACCACCGTCTACCTA
GGCACCAAGGGAAATGAGTTTATTCTCAATGGCAAGCTTCGTGATGTGAACGCCGAAGAGGTTTACTCCCCCCTC
ACCACCCCCGTCTTCGGTCGTCACGTCGTCTACGATTGCCCCAATGCTAAGCTCATGGAGCAGAAGAAGTTTGTC
AAATTCGGGCTTACCTCCGAGGCACTTCGGTCTTATGTTCACTTGATCACCAATGAGGTCGATGACTTTGTGAAG
AATTCCTCCGCGTTCAAGGACCCTAAGGGTACTTTCAATGTTTCCAAGGTCATTGCGGAAATCACAATTTACACA
GCCTCCCGCTCGTTGCAAGGACAGGAAGTCCGCGATCGATTCGACTCGACCTTTGCTGAAATGTACCACGACCTC
GATAAGGGTTTCGCTCCTATCAACTTCATGCTGCCATGGGCCCCGCTCCCTCACAACCGCAAGCGCGATGCTGCG
CAGAAGAAGATGACCGAGACGTACATGGACATCATCAAGGCGCGCCGCGCAGCCGGTGATAAGAAGGACTCCGAG
GATATGGTCTGGAACTTGATGTCGTGCACCTACAAGAATGGAAATCCGATTCCTGATGAGGAAATTGCCCACATG
ATGATTGCGCTGCTTATGGCGGGCCAGCACTCTTCGTCCTCTACTGCTGCCTGGATTGTTCTGCGCCTGGCCAGC
TGCCCTGAGATTGTTGAGGAGCTTTACCAAGAACAACTCCAGGTTCTGGGCTCTGACCTGCCTCCTCTTACCCAC
GAAGCACTCCAGAAGCTCGACTTGCACGCTAAGGTGATCAAGGAAACCCTCCGTATCCACGCTCCTATCCACTCG
ATCATTCGCGCCGTCAAGAACCCCATGCCCGTGGAGGGCACTTCTTATGTCATTCCCACCACTCACAATGTCCTC
TCTTCTCCCGGTGTTACTGCTCGCTCTCCAGAGTTCTTCCCCGAGCCTCTGAAGTGGAACCCTCACCGCTGGGAT
GAGGCTTCAACTGAGAATACCAAGGATGAAGATGAGGAGCAGATCGACTATGGTTATGGATTGGTAACCAAGGGC
ACCAACAGTCCTTATCTGCCTTTCGGTGCTGGTCGCCATCGCTGTATTGGTGAACAGTTCGCCTATGTGCAACTG
GGCACAATCCTGGCTGCGCTGGTGAGACACTTCAAGTTCTCCACGCCTATCGCCGGTACACCCTTCCCCGAGACG
GACTATTCGTCCCTCTTCTCCAAGCCTCTGGGTACATCATTTGTTCAGTATGAGAGACGTGGAGTCAAAGCATGA
Transcript >Pro_DTO377G3_2|g8464.t1
ATGGGCCTCTTCGCAACTTTCCTCGCCACTTTCTGCGAGCACTGCTCGACCCAGTCAATCTACACTTTGGCCAGC
GTCGGGGCACTGTCATTCGTTGCGCTATCGATTGTGATCAATGTGCTGTGCCAGCTCTTCTTCAAGAAATCCCAT
GAGCCCCCCGTGGTCTTCCACTGGGTCCCCTTTATTGGAAGCACCATCAGCTATGGCATGAACCCATACAACTTC
TTCGACCAAGCTCGCGCAAAGTATGGCGACATCTTCACCTTTGTCCTCCTGGGCAAGAAAACCACCGTCTACCTA
GGCACCAAGGGAAATGAGTTTATTCTCAATGGCAAGCTTCGTGATGTGAACGCCGAAGAGGTTTACTCCCCCCTC
ACCACCCCCGTCTTCGGTCGTCACGTCGTCTACGATTGCCCCAATGCTAAGCTCATGGAGCAGAAGAAGTTTGTC
AAATTCGGGCTTACCTCCGAGGCACTTCGGTCTTATGTTCACTTGATCACCAATGAGGTCGATGACTTTGTGAAG
AATTCCTCCGCGTTCAAGGACCCTAAGGGTACTTTCAATGTTTCCAAGGTCATTGCGGAAATCACAATTTACACA
GCCTCCCGCTCGTTGCAAGGACAGGAAGTCCGCGATCGATTCGACTCGACCTTTGCTGAAATGTACCACGACCTC
GATAAGGGTTTCGCTCCTATCAACTTCATGCTGCCATGGGCCCCGCTCCCTCACAACCGCAAGCGCGATGCTGCG
CAGAAGAAGATGACCGAGACGTACATGGACATCATCAAGGCGCGCCGCGCAGCCGGTGATAAGAAGGACTCCGAG
GATATGGTCTGGAACTTGATGTCGTGCACCTACAAGAATGGAAATCCGATTCCTGATGAGGAAATTGCCCACATG
ATGATTGCGCTGCTTATGGCGGGCCAGCACTCTTCGTCCTCTACTGCTGCCTGGATTGTTCTGCGCCTGGCCAGC
TGCCCTGAGATTGTTGAGGAGCTTTACCAAGAACAACTCCAGGTTCTGGGCTCTGACCTGCCTCCTCTTACCCAC
GAAGCACTCCAGAAGCTCGACTTGCACGCTAAGGTGATCAAGGAAACCCTCCGTATCCACGCTCCTATCCACTCG
ATCATTCGCGCCGTCAAGAACCCCATGCCCGTGGAGGGCACTTCTTATGTCATTCCCACCACTCACAATGTCCTC
TCTTCTCCCGGTGTTACTGCTCGCTCTCCAGAGTTCTTCCCCGAGCCTCTGAAGTGGAACCCTCACCGCTGGGAT
GAGGCTTCAACTGAGAATACCAAGGATGAAGATGAGGAGCAGATCGACTATGGTTATGGATTGGTAACCAAGGGC
ACCAACAGTCCTTATCTGCCTTTCGGTGCTGGTCGCCATCGCTGTATTGGTGAACAGTTCGCCTATGTGCAACTG
GGCACAATCCTGGCTGCGCTGGTGAGACACTTCAAGTTCTCCACGCCTATCGCCGGTACACCCTTCCCCGAGACG
GACTATTCGTCCCTCTTCTCCAAGCCTCTGGGTACATCATTTGTTCAGTATGAGAGACGTGGAGTCAAAGCATGA
Gene >Pro_DTO377G3_2|g8464.t1
ATGGGCCTCTTCGCAACTTTCCTCGCCACTTTCTGCGAGCACTGCTCGACCCAGTCAATCTACACTTTGGCCAGC
GTCGGGGCACTGTCATTCGTTGCGCTATCGATTGTGATCAATGTGCTGTGCCAGCTCTTCTTCAAGAAATCCCAT
GAGCCCCCCGTGGTCTTCCACTGGGTCCCCTTTATTGGAAGCACCATCAGCTATGGCATGAACCCATACAACTTC
TTCGACCAAGCTCGCGCAAAGGTATGTCGATCGCAGATGTCTGGCTGGCCCATGGATCAATTCAATTGCTAATCT
GAGGTTAAACGCAGTATGGCGACATCTTCACCTTTGTCCTCCTGGGCAAGAAAACCACCGTCTACCTAGGCACCA
AGGGAAATGAGTTTATTCTCAATGGCAAGCTTCGTGATGTGAACGCCGAAGAGGTTTACTCCCCCCTCACCACCC
CCGTCTTCGGTCGTCACGTCGTCTACGATTGCCCCAATGCTAAGCTCATGGAGCAGAAGAAGGTATGCAGGAATG
GATTACACCAAAAAGTCGGGCTGCTGATTGTTGCCTAGTTTGTCAAATTCGGGCTTACCTCCGAGGCACTTCGGT
CTTATGTTCACTTGATCACCAATGAGGTCGATGACTTTGTGAAGAATTCCTCCGCGTTCAAGGACCCTAAGGGTA
CTTTCAATGTTTCCAAGGTCATTGCGGAAATCACAATTTACACAGCCTCCCGCTCGTTGCAAGGACAGGAAGTCC
GCGATCGATTCGACTCGACCTTTGCTGAAATGTACCACGACCTCGATAAGGGTTTCGCTCCTATCAACTTCATGC
TGCCATGGGCCCCGCTCCCTCACAACCGCAAGCGCGATGCTGCGCAGAAGAAGATGACCGAGACGTACATGGACA
TCATCAAGGCGCGCCGCGCAGCCGGTGATAAGAAGGACTCCGAGGATATGGTCTGGAACTTGATGTCGTGCACCT
ACAAGAATGGAAATCCGATTCCTGATGAGGAAATTGCCCACATGATGATTGCGCTGCTTATGGCGGGCCAGCACT
CTTCGTCCTCTACTGCTGCCTGGATTGTTCTGCGCCTGGCCAGCTGCCCTGAGATTGTTGAGGAGCTTTACCAAG
AACAACTCCAGGTTCTGGGCTCTGACCTGCCTCCTCTTACCCACGAAGCACTCCAGAAGCTCGACTTGCACGCTA
AGGTGATCAAGGAAACCCTCCGTATCCACGCTCCTATCCACTCGATCATTCGCGCCGTCAAGAACCCCATGCCCG
TGGAGGGCACTTCTTATGTCATTCCCACCACTCACAATGTCCTCTCTTCTCCCGGTGTTACTGCTCGCTCTCCAG
AGTTCTTCCCCGAGCCTCTGAAGTGGAACCCTCACCGCTGGGATGAGGCTTCAACTGAGAATACCAAGGATGAAG
ATGAGGAGCAGATCGACTATGGTTATGGATTGGTAACCAAGGGCACCAACAGTCCTTATCTGCCTTTCGGTGCTG
GTCGCCATCGCTGTATTGGTGAACAGTTCGCCTATGTGCAACTGGGCACAATCCTGGCTGCGCTGGTGAGACACT
TCAAGTTCTCCACGCCTATCGCCGGTACACCCTTCCCCGAGACGGACTATTCGGTAAGTGATGCCCTATTGCGAT
CGACCTGGCATTTGACTAACCATATTCTAGTCCCTCTTCTCCAAGCCTCTGGGTACATCATTTGTTCAGTATGAG
AGACGTGGAGTCAAAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail