Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8452.t1
Gene name
Locationscaffold_33:78631..80390
Strand-
Gene length (bp)1759
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02417 Chromate_transp Chromate transporter 4.1E-27 42 211
PF02417 Chromate_transp Chromate transporter 5.4E-35 336 515

GO

GO Term Description Terminal node
GO:0015703 chromate transport Yes
GO:0015109 chromate transmembrane transporter activity Yes
GO:0015075 ion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0015698 inorganic anion transport No
GO:0008509 anion transmembrane transporter activity No
GO:0006820 anion transport No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 115 137 22
2 150 172 22
3 198 220 22
4 306 328 22
5 343 362 19
6 374 396 22
7 411 433 22
8 445 467 22
9 500 522 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8452.t1
MPLLAPFSRGLSSLSRLNHKRGSRVSSENGGSGKPLPSRLLDVFLRTWDLGFTAFGGPPVHFQILHSRFVEGKGD
KEKWVDEQTYQELFAICQGLPGPGSTKMVFCLALLHAGFIPAMLVFLLWSLPGAVGMYALSLGVQNMSETLPEPA
YSLLSGLNASTVGIVALAAVQLSEKAIRDKLSRILVIFGACAGLCYNALWYFPVLMVIGGFLTSIWDGWLYQQFL
RAKLAWKDRHHRPQEPYKANGNSIAMDDTTLGENRVQRSETTRSRRTDPRVEELPQSTVDTTSPMPSVEADTQQH
IIRIRIGLLIMFLFFASFIAILVARGQITTPPLVLDLFANMYLAGTVIFGGGPVVIPLLRSYVVDPGWVSSRDFL
IGLAIIQAFPGPNFNFAVFLGALALQRSQFPTAFGAFLGGLGIFLPGITLAVAIQSFWRVLRKKKYVVDFLRGVN
ATAVGLVYTAVYRLWEIGYLTSERSDGQSLGKEPWWVVVAAVTYSGSAWFNVAPPVAIVMGAILGLCWYGVVGR*
Coding >Pro_DTO377G3_2|g8452.t1
ATGCCACTCCTCGCCCCCTTTTCCCGAGGCCTCTCTTCCCTCTCTCGTCTGAATCACAAACGGGGAAGCCGGGTT
TCAAGTGAAAATGGGGGATCGGGAAAGCCCCTGCCGAGCCGTCTGTTGGACGTTTTTCTGCGTACATGGGATCTA
GGCTTTACAGCCTTCGGAGGACCACCAGTACACTTCCAGATTCTACACAGCAGGTTCGTGGAGGGAAAGGGCGAC
AAGGAAAAATGGGTAGATGAACAGACTTATCAGGAACTCTTTGCTATCTGTCAGGGTCTTCCGGGTCCCGGTAGC
ACGAAGATGGTTTTTTGCCTAGCCCTATTACACGCAGGATTTATTCCTGCCATGCTTGTGTTTCTACTTTGGAGT
CTTCCTGGCGCAGTTGGCATGTATGCCCTCTCACTTGGGGTGCAAAACATGAGTGAAACTCTTCCCGAACCTGCC
TACTCCTTACTTTCTGGCCTCAATGCCTCTACAGTGGGTATCGTTGCACTTGCGGCTGTACAGTTGTCCGAAAAA
GCTATTCGCGATAAACTGTCCCGTATCCTCGTGATCTTTGGCGCATGTGCTGGTCTCTGTTACAATGCACTCTGG
TATTTTCCCGTGCTGATGGTTATCGGTGGTTTCCTCACCAGCATCTGGGATGGATGGTTGTATCAGCAATTTTTG
AGAGCAAAACTCGCGTGGAAGGACAGACATCATCGTCCCCAGGAACCGTATAAGGCAAATGGGAACTCCATAGCC
ATGGATGATACAACTCTGGGAGAGAATAGAGTCCAAAGGAGTGAGACGACACGATCGCGAAGGACGGATCCTAGA
GTCGAGGAACTACCACAGAGCACAGTTGATACTACAAGCCCAATGCCGTCCGTTGAAGCTGACACACAACAGCAC
ATTATTCGGATTCGGATTGGACTTCTGATTATGTTTCTCTTTTTCGCGTCCTTCATCGCAATTCTTGTTGCCAGA
GGCCAGATCACCACACCCCCATTGGTCCTAGACCTCTTCGCCAATATGTACCTTGCCGGCACTGTTATCTTTGGT
GGAGGTCCTGTCGTCATTCCCCTCTTACGCTCCTATGTCGTCGATCCCGGGTGGGTCTCTAGTAGAGACTTCCTG
ATCGGCCTTGCCATTATTCAAGCCTTCCCCGGTCCTAACTTCAACTTCGCTGTCTTTTTGGGAGCACTAGCACTA
CAGCGCTCGCAATTCCCGACCGCCTTCGGTGCGTTCCTCGGCGGTTTAGGAATCTTCCTTCCGGGAATCACGCTG
GCCGTTGCAATCCAAAGCTTCTGGCGCGTGTTGCGGAAGAAGAAGTATGTGGTCGACTTCCTCAGAGGAGTGAAT
GCCACTGCAGTTGGGCTAGTATATACAGCTGTATACCGGTTGTGGGAGATTGGATACCTGACTTCTGAAAGAAGC
GACGGACAGAGTCTGGGTAAGGAACCATGGTGGGTGGTTGTTGCGGCAGTAACATATTCGGGGAGCGCATGGTTC
AATGTTGCCCCACCCGTGGCGATTGTAATGGGTGCTATCTTAGGGTTATGCTGGTATGGAGTAGTGGGACGATAG
Transcript >Pro_DTO377G3_2|g8452.t1
ATGCCACTCCTCGCCCCCTTTTCCCGAGGCCTCTCTTCCCTCTCTCGTCTGAATCACAAACGGGGAAGCCGGGTT
TCAAGTGAAAATGGGGGATCGGGAAAGCCCCTGCCGAGCCGTCTGTTGGACGTTTTTCTGCGTACATGGGATCTA
GGCTTTACAGCCTTCGGAGGACCACCAGTACACTTCCAGATTCTACACAGCAGGTTCGTGGAGGGAAAGGGCGAC
AAGGAAAAATGGGTAGATGAACAGACTTATCAGGAACTCTTTGCTATCTGTCAGGGTCTTCCGGGTCCCGGTAGC
ACGAAGATGGTTTTTTGCCTAGCCCTATTACACGCAGGATTTATTCCTGCCATGCTTGTGTTTCTACTTTGGAGT
CTTCCTGGCGCAGTTGGCATGTATGCCCTCTCACTTGGGGTGCAAAACATGAGTGAAACTCTTCCCGAACCTGCC
TACTCCTTACTTTCTGGCCTCAATGCCTCTACAGTGGGTATCGTTGCACTTGCGGCTGTACAGTTGTCCGAAAAA
GCTATTCGCGATAAACTGTCCCGTATCCTCGTGATCTTTGGCGCATGTGCTGGTCTCTGTTACAATGCACTCTGG
TATTTTCCCGTGCTGATGGTTATCGGTGGTTTCCTCACCAGCATCTGGGATGGATGGTTGTATCAGCAATTTTTG
AGAGCAAAACTCGCGTGGAAGGACAGACATCATCGTCCCCAGGAACCGTATAAGGCAAATGGGAACTCCATAGCC
ATGGATGATACAACTCTGGGAGAGAATAGAGTCCAAAGGAGTGAGACGACACGATCGCGAAGGACGGATCCTAGA
GTCGAGGAACTACCACAGAGCACAGTTGATACTACAAGCCCAATGCCGTCCGTTGAAGCTGACACACAACAGCAC
ATTATTCGGATTCGGATTGGACTTCTGATTATGTTTCTCTTTTTCGCGTCCTTCATCGCAATTCTTGTTGCCAGA
GGCCAGATCACCACACCCCCATTGGTCCTAGACCTCTTCGCCAATATGTACCTTGCCGGCACTGTTATCTTTGGT
GGAGGTCCTGTCGTCATTCCCCTCTTACGCTCCTATGTCGTCGATCCCGGGTGGGTCTCTAGTAGAGACTTCCTG
ATCGGCCTTGCCATTATTCAAGCCTTCCCCGGTCCTAACTTCAACTTCGCTGTCTTTTTGGGAGCACTAGCACTA
CAGCGCTCGCAATTCCCGACCGCCTTCGGTGCGTTCCTCGGCGGTTTAGGAATCTTCCTTCCGGGAATCACGCTG
GCCGTTGCAATCCAAAGCTTCTGGCGCGTGTTGCGGAAGAAGAAGTATGTGGTCGACTTCCTCAGAGGAGTGAAT
GCCACTGCAGTTGGGCTAGTATATACAGCTGTATACCGGTTGTGGGAGATTGGATACCTGACTTCTGAAAGAAGC
GACGGACAGAGTCTGGGTAAGGAACCATGGTGGGTGGTTGTTGCGGCAGTAACATATTCGGGGAGCGCATGGTTC
AATGTTGCCCCACCCGTGGCGATTGTAATGGGTGCTATCTTAGGGTTATGCTGGTATGGAGTAGTGGGACGATAG
Gene >Pro_DTO377G3_2|g8452.t1
ATGCCACTCCTCGCCCCCTTTTCCCGAGGCCTCTCTTCCCTCTCTCGTCTGAATCACAAACGGGGAAGCCGGGTT
TCAAGTGAAAATGGGGGATCGGGAAAGCCCCTGCCGAGCCGTCTGTTGGACGTTTTTCTGCGTACATGGGATCTA
GGCTTTACAGCCTTCGGAGGACCACCAGTACACTTCCAGATTCTACACAGCAGGTTCGTGGAGGGAAAGGGCGAC
AAGGAAAAATGGGTAGATGAACAGACTGTATGAATCTCCCTTATCTTCAAGTTGGCGTGTCCCGATGTCATAGGG
CCTCCTAACAAATTTCATAGTATCAGGAACTCTTTGCTATCTGTCAGGGTCTTCCGGGTCCCGGTAGCACGAAGA
TGGTTTTTTGCCTAGCCCTATTACACGCAGGATTTATTCCTGCCATGCTTGTGTTTCTACTTTGGAGGTGATTAA
TTCATACCCTTATGCTGCAATGCCCGCCATCTGTAGACTTCAACTAACGGTTTCAGTCTTCCTGGCGCAGTTGGC
ATGTATGCCCTCTCACTTGGGGTGCAAAACATGAGTGAAACTCTTCCCGAACCTGCCTACTCCTTACTTTCTGGC
CTCAATGCCTCTACAGTGGGTATCGTTGCACTTGCGGCTGTACAGTTGTCCGAAAAAGCTATTCGCGATAAACTG
TCCCGTATCCTCGTGATCTTTGGCGCATGTGCTGGTCTCTGTTACAATGCACTCTGGTATTTTCCCGTGCTGATG
GTTATCGGTGGTTTCCTCACCAGCATCTGGGATGGATGGTTGTATCAGCAATTTTTGAGAGCAAAACTCGCGTGG
AAGGACAGACATCATCGTCCCCAGGAACCGTATAAGGCAAATGGGAACTCCATAGCCATGGATGATACAACTCTG
GGAGAGAATAGAGTCCAAAGGAGTGAGACGACACGATCGCGAAGGACGGATCCTAGAGTCGAGGAACTACCACAG
AGCACAGTTGATACTACAAGCCCAATGCCGTCCGTTGAAGCTGACACACAACAGCACATTATTCGGATTCGGATT
GGACTTCTGATTATGTTTCTCTTTTTCGGTGCGCACCCCATTCTGACAAGATCCCTAAGCGTCAACACTAATATA
GTTAGCGTCCTTCATCGCAATTCTTGTTGCCAGAGGCCAGATCACCACACCCCCATTGGTCCTAGACCTCTTCGC
CAATATGTACCTTGCCGGCACTGTTATCTTTGGTGGAGGTCCTGTCGTCATTCCCCTCTTACGCTCCTATGTCGT
CGATCCCGGGTGGGTCTCTAGTAGAGACTTCCTGATCGGCCTTGCCATTATTCAAGCCTTCCCCGGTCCTAACTT
CAACTTCGCTGTCTTTTTGGGAGCACTAGCACTACAGCGCTCGCAATTCCCGACCGCCTTCGGTGCGTTCCTCGG
CGGTTTAGGAATCTTCCTTCCGGGAATCACGCTGGCCGTTGCAATCCAAAGCTTCTGGCGCGTGTTGCGGAAGAA
GAAGTATGTGGTCGACTTCCTCAGAGGAGTGAATGCCACTGCAGTTGGGCTAGTATATACAGCTGTATACCGGTT
GTGGGAGATTGGATACCTGACTTCTGAAAGAAGCGACGGACAGAGTCTGGGTAAGGAACCATGGTGGGTGGTTGT
TGCGGCAGTAACATATTCGGGGAGCGCATGGTTCAATGTTGCCCCACCCGTGGCGATTGTAATGGGTGCTATCTT
AGGGTTATGCTGGTATGGAGTAGTGGGACGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail