Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8439.t1
Gene name
Locationscaffold_32:223380..224847
Strand+
Gene length (bp)1467
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01244 Peptidase_M19 Membrane dipeptidase (Peptidase family M19) 3.2E-102 10 338

GO

GO Term Description Terminal node
GO:0070573 metallodipeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016805 dipeptidase activity No
GO:0008238 exopeptidase activity No
GO:0019538 protein metabolic process No
GO:0008235 metalloexopeptidase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0008237 metallopeptidase activity No
GO:0016787 hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8439.t1
MSMEEAIDILNSVPLIDGHNDWPHLIRGFYDNQLDIRLDPEKDLVGHVDFKRLREGKSGGAFWSVYIDCPDSDDF
TDDAAHLETLRDTLQQIDLVHRLVDLYSDHMGLVDRASDIMRLFTDGKFASLIGVEGLHQIANSSSVLRLYHKLG
VRYVTLAHNKNNLYADSATAISPAHDGLSSKGELIVREMNRIGMIIDLSHTSESVMHQVLDISKAPVIFSHSSTS
SIVPHPRNVPDAILEKLKANKGVIMITFIPSLAHIDPTQGNMDHVIDHIMHVGQNIGYDHVGLGSDYDGMFNAVK
GIENVARYPHLVRRMLERGIARSDVEKIIGLNVIRVLNDVEVQSASNKSQVPIMQDGVKQLWNEKFRGVVRGAYP
DAEMDLPRALIPEKSK*
Coding >Pro_DTO377G3_2|g8439.t1
ATGTCTATGGAGGAGGCCATCGATATCCTGAATTCAGTCCCACTGATTGATGGACACAACGACTGGCCACACCTC
ATTCGCGGGTTTTACGACAATCAACTGGATATTCGGTTGGATCCGGAAAAGGACCTAGTGGGACATGTTGATTTC
AAGCGACTCAGAGAAGGGAAATCTGGTGGTGCCTTCTGGAGTGTTTACATAGACTGCCCAGACTCAGACGACTTC
ACCGACGATGCGGCACACCTAGAGACGTTGAGAGATACACTGCAGCAAATCGATCTAGTGCATCGACTGGTGGAT
TTGTATTCAGACCACATGGGTCTCGTTGATCGTGCCTCCGATATCATGCGCTTGTTCACTGATGGGAAATTTGCT
AGCCTAATCGGCGTCGAAGGGCTCCATCAGATTGCAAACAGCTCCAGTGTTCTTCGGTTGTATCATAAACTTGGA
GTCCGATATGTCACATTAGCGCACAATAAGAATAATCTGTACGCAGATAGCGCAACCGCAATATCTCCAGCACAT
GACGGACTATCTTCTAAGGGCGAATTGATAGTCAGGGAAATGAACAGAATTGGAATGATCATTGACCTCTCCCAT
ACAAGCGAATCTGTGATGCACCAAGTGTTGGATATTTCCAAAGCGCCTGTGATTTTCTCTCACTCGTCGACATCC
TCCATCGTTCCACATCCTCGCAATGTCCCCGACGCTATTCTCGAGAAACTAAAAGCCAACAAGGGAGTGATTATG
ATCACATTTATTCCCTCTCTTGCTCACATTGATCCCACCCAAGGGAACATGGACCATGTCATTGATCACATTATG
CATGTTGGACAAAATATTGGCTACGATCATGTTGGGCTTGGATCTGACTATGACGGTATGTTTAATGCTGTAAAA
GGAATTGAGAATGTCGCTCGATATCCTCATTTGGTTCGCAGAATGCTGGAGCGTGGGATTGCCCGATCGGATGTG
GAAAAGATCATAGGGCTTAATGTGATCCGTGTATTGAACGATGTGGAAGTGCAATCAGCTTCAAACAAATCTCAA
GTACCAATCATGCAGGATGGAGTGAAGCAACTGTGGAACGAGAAATTCCGAGGTGTTGTGAGAGGGGCTTATCCT
GATGCAGAGATGGATTTGCCTAGAGCCCTCATACCGGAGAAAAGCAAGTGA
Transcript >Pro_DTO377G3_2|g8439.t1
ATGTCTATGGAGGAGGCCATCGATATCCTGAATTCAGTCCCACTGATTGATGGACACAACGACTGGCCACACCTC
ATTCGCGGGTTTTACGACAATCAACTGGATATTCGGTTGGATCCGGAAAAGGACCTAGTGGGACATGTTGATTTC
AAGCGACTCAGAGAAGGGAAATCTGGTGGTGCCTTCTGGAGTGTTTACATAGACTGCCCAGACTCAGACGACTTC
ACCGACGATGCGGCACACCTAGAGACGTTGAGAGATACACTGCAGCAAATCGATCTAGTGCATCGACTGGTGGAT
TTGTATTCAGACCACATGGGTCTCGTTGATCGTGCCTCCGATATCATGCGCTTGTTCACTGATGGGAAATTTGCT
AGCCTAATCGGCGTCGAAGGGCTCCATCAGATTGCAAACAGCTCCAGTGTTCTTCGGTTGTATCATAAACTTGGA
GTCCGATATGTCACATTAGCGCACAATAAGAATAATCTGTACGCAGATAGCGCAACCGCAATATCTCCAGCACAT
GACGGACTATCTTCTAAGGGCGAATTGATAGTCAGGGAAATGAACAGAATTGGAATGATCATTGACCTCTCCCAT
ACAAGCGAATCTGTGATGCACCAAGTGTTGGATATTTCCAAAGCGCCTGTGATTTTCTCTCACTCGTCGACATCC
TCCATCGTTCCACATCCTCGCAATGTCCCCGACGCTATTCTCGAGAAACTAAAAGCCAACAAGGGAGTGATTATG
ATCACATTTATTCCCTCTCTTGCTCACATTGATCCCACCCAAGGGAACATGGACCATGTCATTGATCACATTATG
CATGTTGGACAAAATATTGGCTACGATCATGTTGGGCTTGGATCTGACTATGACGGTATGTTTAATGCTGTAAAA
GGAATTGAGAATGTCGCTCGATATCCTCATTTGGTTCGCAGAATGCTGGAGCGTGGGATTGCCCGATCGGATGTG
GAAAAGATCATAGGGCTTAATGTGATCCGTGTATTGAACGATGTGGAAGTGCAATCAGCTTCAAACAAATCTCAA
GTACCAATCATGCAGGATGGAGTGAAGCAACTGTGGAACGAGAAATTCCGAGGTGTTGTGAGAGGGGCTTATCCT
GATGCAGAGATGGATTTGCCTAGAGCCCTCATACCGGAGAAAAGCAAGTGA
Gene >Pro_DTO377G3_2|g8439.t1
ATGTCTATGGAGGAGGCCATCGATATCCTGAATTCAGTCCCACTGATTGGTGTGTGTCCTGCTAGTGGGCTATGT
TCGAGACCCCAAGGCTGACAATCCACCTAGATGGACACAACGACTGGCCACACCTCATTCGCGGGTTTTACGACA
ATCAACTGGATATTCGGTTGGATCCGGAAAAGGACCTAGTGGGACATGTTGATTTCAAGCGACTCAGAGAAGGGA
AATCTGGTGGTGCCTTCTGGAGTGTTTACATAGACTGGTAGCCTGGATACCGCGACCTACAATATTGTCTTCAGC
TGATGATATTCTTAGCCCAGACTCAGACGACTTCACCGACGATGCGGCACACCTAGAGACGTTGAGAGATACACT
GCAGCAAATCGATCTAGTGCATCGACTGGTGGATTTGTATTCAGACCACATGGGTCTCGTTGATCGTGCCTCCGA
TATCATGCGCTTGTTCACTGATGGGAAATTTGCTAGCCTAATCGGCGTCGAAGGGCTCCATCAGATTGCAAACAG
CTCCAGTGTTCTTCGGTTGTATCATAAACTTGGAGTCCGATATGTCACATTAGCGCACAATAAGAATAATCTGTA
CGCAGATAGCGCAGTGAGTGATAACCAATTAACGAACAAGTGACAGGAGCTAAAATGACTAGACCGCAATATCTC
CAGCACATGACGGACTATCTTCTAAGGGCGAATTGATAGTCAGGGAAATGAACAGAATTGGAATGTAAGAATGAT
CTTGTCAACATATATTCTCCCGCAAAAGTCACAAAGCTAACCAGAATTAGGATCATTGACCTCTCCCATACAAGC
GAATCTGTGATGCACCAAGTGTTGGATATTTCCAAAGCGCCTGTGATTTTCTCTCACTCGTCGACGTAAGTTATC
CCAAGCGATTTCTCAGCCAGACTGCTGCAAAAGAAAGTCCCATCTGAACCTTAAGCGTACAGATCCTCCATCGTT
CCACATCCTCGCAATGTCCCCGACGCTATTCTCGAGAAACTAAAAGCCAACAAGGGAGTGATTATGATCACATTT
ATTCCCTCTCTTGCTCACATTGATCCCACCCAAGGGAACATGGACCATGTCATTGATCACATTATGCATGTTGGA
CAAAATATTGGCTACGATCATGTTGGGCTTGGATCTGACTATGACGGTATGTTTAATGCTGTAAAAGGAATTGAG
AATGTCGCTCGATATCCTCATTTGGTTCGCAGAATGCTGGAGCGTGGGATTGCCCGATCGGATGTGGAAAAGATC
ATAGGGCTTAATGTGATCCGTGTATTGAACGATGTGGAAGTGCAATCAGCTTCAAACAAATCTCAAGTACCAATC
ATGCAGGATGGAGTGAAGCAACTGTGGAACGAGAAATTCCGAGGTGTTGTGAGAGGGGCTTATCCTGATGCAGAG
ATGGATTTGCCTAGAGCCCTCATACCGGAGAAAAGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail