Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8436.t1
Gene name
Locationscaffold_32:218664..219551
Strand-
Gene length (bp)887
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 6.2E-06 32 107
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.2E-05 165 227

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006749 glutathione metabolic process Yes
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006518 peptide metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0003674 molecular_function No
GO:0006575 cellular modified amino acid metabolic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 5.85 1.23 10.46
5d_25C Five days - 25 degrees Celsius 8.84 2.43 15.25
7d_25C Seven days - 25 degrees Celsius 9.34 2.52 16.17
10d_25C Ten days - 25 degrees Celsius 16.68 6.25 27.11
7d_15C Seven days - 15 degrees Celsius 6.27 1.39 11.15
7d_30C Seven days - 30 degrees Celsius 7.42 1.95 12.88

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.394036 no
3d_25C 7d_25C 0.324447 no
3d_25C 7d_15C 0.919424 no
3d_25C 7d_30C 0.668535 no
3d_25C 10d_25C 0.009124 yes
5d_25C 7d_25C 0.931971 no
5d_25C 7d_15C 0.494972 no
5d_25C 7d_30C 0.752899 no
5d_25C 10d_25C 0.094678 no
7d_25C 7d_15C 0.410548 no
7d_25C 7d_30C 0.662315 no
7d_25C 10d_25C 0.124773 no
7d_15C 7d_30C 0.775208 no
7d_15C 10d_25C 0.013211 yes
7d_30C 10d_25C 0.026584 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8436.t1
MSQPSEDLSVRPQIPDDKLVLYVKKSSPTSTANAVKPLMLIQALKIPHELHIINSTSNETWFHSINPYKMVPAME
DVEIYQVNGKPQRLNIFDSSACLTYLAEKYDQEGLYNGKDLCERTIVMNWLMSYTAGLGATGKIWLLMKAPKPVD
IGESLSVLLKYICTEYQFLETRLNEPGQHYIALPDRPTIADFAILPLANETIATSAKLDFGQWPKLKEWSEKMRE
LPPVKEALNRISRIGLSDEELMELDRKD*
Coding >Pro_DTO377G3_2|g8436.t1
ATGTCCCAGCCAAGCGAAGATCTATCCGTGCGGCCTCAAATCCCCGATGACAAGCTAGTCTTGTACGTCAAAAAA
TCGAGTCCCACATCCACGGCCAACGCCGTGAAGCCGCTGATGCTCATTCAGGCCCTGAAAATTCCTCACGAACTT
CATATCATCAATTCAACCAGCAACGAAACATGGTTTCACTCGATCAACCCTTATAAGATGGTCCCCGCCATGGAG
GACGTCGAAATTTACCAGGTCAACGGCAAGCCGCAGCGGCTGAACATTTTCGATAGCTCTGCATGTCTAACTTAC
CTGGCGGAGAAGTACGACCAAGAGGGACTTTACAATGGCAAAGACCTCTGTGAACGAACCATTGTCATGAACTGG
TTGATGTCCTACACTGCGGGGTTGGGTGCAACCGGCAAGATTTGGCTTTTGATGAAAGCACCGAAGCCAGTGGAT
ATTGGCGAATCTCTTTCGGTGTTGCTGAAATACATTTGCACCGAGTATCAGTTCCTGGAAACTCGGCTGAATGAA
CCTGGCCAGCATTACATAGCTTTGCCCGACAGACCGACCATTGCGGACTTTGCCATCTTGCCTCTTGCGAATGAA
ACTATCGCAACGTCCGCCAAGCTGGACTTTGGCCAATGGCCAAAATTGAAGGAGTGGAGTGAGAAGATGAGAGAG
CTACCGCCGGTCAAGGAGGCTTTGAATAGAATCTCTCGGATTGGATTATCCGATGAAGAGCTCATGGAGCTGGAT
CGCAAAGATTAG
Transcript >Pro_DTO377G3_2|g8436.t1
ATGTCCCAGCCAAGCGAAGATCTATCCGTGCGGCCTCAAATCCCCGATGACAAGCTAGTCTTGTACGTCAAAAAA
TCGAGTCCCACATCCACGGCCAACGCCGTGAAGCCGCTGATGCTCATTCAGGCCCTGAAAATTCCTCACGAACTT
CATATCATCAATTCAACCAGCAACGAAACATGGTTTCACTCGATCAACCCTTATAAGATGGTCCCCGCCATGGAG
GACGTCGAAATTTACCAGGTCAACGGCAAGCCGCAGCGGCTGAACATTTTCGATAGCTCTGCATGTCTAACTTAC
CTGGCGGAGAAGTACGACCAAGAGGGACTTTACAATGGCAAAGACCTCTGTGAACGAACCATTGTCATGAACTGG
TTGATGTCCTACACTGCGGGGTTGGGTGCAACCGGCAAGATTTGGCTTTTGATGAAAGCACCGAAGCCAGTGGAT
ATTGGCGAATCTCTTTCGGTGTTGCTGAAATACATTTGCACCGAGTATCAGTTCCTGGAAACTCGGCTGAATGAA
CCTGGCCAGCATTACATAGCTTTGCCCGACAGACCGACCATTGCGGACTTTGCCATCTTGCCTCTTGCGAATGAA
ACTATCGCAACGTCCGCCAAGCTGGACTTTGGCCAATGGCCAAAATTGAAGGAGTGGAGTGAGAAGATGAGAGAG
CTACCGCCGGTCAAGGAGGCTTTGAATAGAATCTCTCGGATTGGATTATCCGATGAAGAGCTCATGGAGCTGGAT
CGCAAAGATTAG
Gene >Pro_DTO377G3_2|g8436.t1
ATGTCCCAGCCAAGCGAAGATCTATCCGTGCGGCCTCAAATCCCCGATGACAAGCTAGTCTTGTACGTCAAAAAA
TGTAAGAAAGTCCAACACTACGGTCAAAATCCATGGCGAAATCCAGTCAATTGATCTTGTATCCCTTCATTTATG
ATCGGGATGAGCCTTGGTCTTCCCACTTTTACGGCTACTAACTGCCTACAGCGAGTCCCACATCCACGGCCAACG
CCGTGAAGCCGCTGATGCTCATTCAGGCCCTGAAAATTCCTCACGAACTTCATATCATCAATTCAACCAGCAACG
AAACATGGTTTCACTCGATCAACCCTTATAAGATGGTCCCCGCCATGGAGGACGTCGAAATTTACCAGGTCAACG
GCAAGCCGCAGCGGCTGAACATTTTCGATAGCTCTGCATGTCTAACTTACCTGGCGGAGAAGTACGACCAAGAGG
GACTTTACAATGGCAAAGACCTCTGTGAACGAACCATTGTCATGAACTGGTTGATGTCCTACACTGCGGGGTTGG
GTGCAACCGGCAAGATTTGGCTTTTGATGAAAGCACCGAAGCCAGTGGATATTGGCGAATCTCTTTCGGTGTTGC
TGAAATACATTTGCACCGAGTATCAGTTCCTGGAAACTCGGCTGAATGAACCTGGCCAGCATTACATAGCTTTGC
CCGACAGACCGACCATTGCGGACTTTGCCATCTTGCCTCTTGCGAATGAAACTATCGCAACGTCCGCCAAGCTGG
ACTTTGGCCAATGGCCAAAATTGAAGGAGTGGAGTGAGAAGATGAGAGAGCTACCGCCGGTCAAGGAGGCTTTGA
ATAGAATCTCTCGGATTGGATTATCCGATGAAGAGCTCATGGAGCTGGATCGCAAAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail