Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g8428.t1
Gene name
Locationscaffold_32:196885..198615
Strand+
Gene length (bp)1730
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.5E-144 54 509
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-18 93 353

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22
2 100 122 22
3 129 146 17
4 156 175 19
5 188 210 22
6 220 242 22
7 305 327 22
8 342 364 22
9 373 395 22
10 410 432 22
11 445 467 22
12 473 495 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.47 0.17 2.77
5d_25C Five days - 25 degrees Celsius 0.69 0.00 1.40
7d_25C Seven days - 25 degrees Celsius 0.31 0.00 0.71
10d_25C Ten days - 25 degrees Celsius 0.20 0.00 0.49
7d_15C Seven days - 15 degrees Celsius 0.49 0.00 1.06
7d_30C Seven days - 30 degrees Celsius 0.48 0.00 1.02

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.165334 no
3d_25C 7d_25C 0.023923 yes
3d_25C 7d_15C 0.071858 no
3d_25C 7d_30C 0.073139 no
3d_25C 10d_25C 0.021163 yes
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 1.000000 no
5d_25C 7d_30C 1.000000 no
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 1.000000 no
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 1.000000 no
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g8428.t1
MGAESFPHHGESITQAQQPSLESSPQNSPMEKHMRPVGIDTPIPRITMRSLVMALFVSMGGLLFGYDTGQISGFQ
EMSNYLERYGELGADGSYKFSTVRSGLIVALLSIGTMIGALVGAPVADKLGRKWSITLWCMILNVGLIVQITSPD
GHWYQMVVGRWVTGLGVGGCSLLVPMYQGESAPRHIRGAMISCYQLFVTLGIFLAYCINLGTHTLDGTAQWRITL
GITFVFALILGGGMIFFPESPRYEFRHGKAESAQSTLAKLYGIPENHVRILEEMNEIREQFEAESEGQKWDEFLT
APRMFYRIVLGMVLQSLQQLSGANYFFYYGTTIFEGAGLSDSFVTQCILGAVNFGTTFGGLYVVENFGRRKSLIY
GAIWMFIMFMIFSSIGHFVLDVETPTNTPNAGKGMIVVACLFIAAYAMTWGPMVWAIVAELFPSKYRAKGMALAT
ATNWLWNFLISFFTTFITKDIDFAYGYVFAGCLFVAIGVVYFFVIEGKGRTLEELDWMYVNKVVPWKSSSYEIPE
RHQDWIADENPYGRKSEGTIHAENA*
Coding >Pro_DTO377G3_2|g8428.t1
ATGGGTGCCGAATCGTTCCCCCACCATGGGGAGTCCATCACACAGGCTCAACAGCCAAGCCTCGAGTCGTCCCCT
CAAAATAGTCCTATGGAGAAACACATGCGACCCGTGGGTATCGATACCCCAATCCCTCGGATAACCATGCGGTCC
TTGGTGATGGCCCTCTTTGTCTCGATGGGTGGTCTGCTGTTTGGATATGACACAGGTCAGATTTCTGGCTTCCAA
GAAATGAGCAACTACTTGGAGCGGTATGGTGAGCTTGGCGCCGATGGTTCCTATAAATTCAGCACCGTGCGCTCC
GGTCTCATTGTCGCCTTGTTGTCCATCGGTACCATGATCGGTGCCCTGGTCGGAGCCCCCGTCGCCGATAAATTG
GGCCGGAAGTGGTCCATCACCCTCTGGTGTATGATCCTCAACGTCGGTTTGATCGTTCAAATTACCTCTCCCGAT
GGCCATTGGTACCAGATGGTTGTTGGCCGCTGGGTCACTGGTCTTGGTGTTGGTGGCTGCTCGCTGCTCGTGCCC
ATGTACCAGGGTGAAAGTGCACCTCGTCACATCCGGGGTGCCATGATCAGTTGCTACCAGCTGTTTGTTACTCTC
GGCATTTTCTTGGCCTACTGCATCAACCTGGGTACTCACACTCTGGATGGCACTGCTCAGTGGCGTATCACTCTC
GGTATCACCTTCGTCTTCGCTCTGATTCTCGGAGGCGGTATGATCTTCTTCCCGGAAAGCCCACGTTATGAATTT
CGCCACGGAAAGGCCGAGAGTGCCCAAAGCACCCTGGCCAAGCTCTACGGCATCCCAGAGAACCATGTCCGCATC
TTGGAAGAAATGAACGAGATTCGTGAGCAGTTTGAAGCGGAGTCTGAGGGCCAGAAGTGGGATGAATTCCTCACT
GCCCCCCGCATGTTCTATCGTATTGTCCTTGGCATGGTTCTGCAGTCACTGCAGCAGCTCAGCGGTGCTAACTAC
TTTTTCTACTACGGTACCACTATCTTCGAAGGCGCTGGTCTCTCGGACAGCTTCGTGACCCAGTGTATCCTTGGT
GCTGTGAATTTTGGAACTACATTTGGCGGCCTATATGTCGTGGAAAATTTCGGTCGTCGCAAGTCCCTGATCTAC
GGAGCCATCTGGATGTTTATCATGTTTATGATCTTCTCATCCATCGGCCATTTCGTTCTGGATGTGGAAACACCT
ACCAATACCCCCAACGCTGGCAAGGGTATGATTGTCGTCGCTTGCTTGTTCATTGCGGCATATGCTATGACCTGG
GGTCCCATGGTTTGGGCGATTGTCGCAGAGCTCTTCCCCTCAAAGTACCGTGCCAAGGGTATGGCCTTAGCTACT
GCAACGAACTGGCTGTGGAACTTCCTCATCAGCTTTTTCACAACTTTCATCACCAAGGACATCGACTTTGCCTAT
GGATACGTCTTCGCTGGTTGCCTTTTCGTGGCTATCGGCGTCGTCTATTTCTTCGTTATTGAAGGAAAGGGCCGT
ACACTTGAGGAGCTTGACTGGATGTATGTCAACAAGGTTGTTCCCTGGAAGAGCAGCAGCTACGAGATTCCCGAA
CGCCACCAGGACTGGATTGCGGATGAGAACCCTTACGGTCGGAAGTCAGAGGGAACCATACACGCAGAGAACGCA
TGA
Transcript >Pro_DTO377G3_2|g8428.t1
ATGGGTGCCGAATCGTTCCCCCACCATGGGGAGTCCATCACACAGGCTCAACAGCCAAGCCTCGAGTCGTCCCCT
CAAAATAGTCCTATGGAGAAACACATGCGACCCGTGGGTATCGATACCCCAATCCCTCGGATAACCATGCGGTCC
TTGGTGATGGCCCTCTTTGTCTCGATGGGTGGTCTGCTGTTTGGATATGACACAGGTCAGATTTCTGGCTTCCAA
GAAATGAGCAACTACTTGGAGCGGTATGGTGAGCTTGGCGCCGATGGTTCCTATAAATTCAGCACCGTGCGCTCC
GGTCTCATTGTCGCCTTGTTGTCCATCGGTACCATGATCGGTGCCCTGGTCGGAGCCCCCGTCGCCGATAAATTG
GGCCGGAAGTGGTCCATCACCCTCTGGTGTATGATCCTCAACGTCGGTTTGATCGTTCAAATTACCTCTCCCGAT
GGCCATTGGTACCAGATGGTTGTTGGCCGCTGGGTCACTGGTCTTGGTGTTGGTGGCTGCTCGCTGCTCGTGCCC
ATGTACCAGGGTGAAAGTGCACCTCGTCACATCCGGGGTGCCATGATCAGTTGCTACCAGCTGTTTGTTACTCTC
GGCATTTTCTTGGCCTACTGCATCAACCTGGGTACTCACACTCTGGATGGCACTGCTCAGTGGCGTATCACTCTC
GGTATCACCTTCGTCTTCGCTCTGATTCTCGGAGGCGGTATGATCTTCTTCCCGGAAAGCCCACGTTATGAATTT
CGCCACGGAAAGGCCGAGAGTGCCCAAAGCACCCTGGCCAAGCTCTACGGCATCCCAGAGAACCATGTCCGCATC
TTGGAAGAAATGAACGAGATTCGTGAGCAGTTTGAAGCGGAGTCTGAGGGCCAGAAGTGGGATGAATTCCTCACT
GCCCCCCGCATGTTCTATCGTATTGTCCTTGGCATGGTTCTGCAGTCACTGCAGCAGCTCAGCGGTGCTAACTAC
TTTTTCTACTACGGTACCACTATCTTCGAAGGCGCTGGTCTCTCGGACAGCTTCGTGACCCAGTGTATCCTTGGT
GCTGTGAATTTTGGAACTACATTTGGCGGCCTATATGTCGTGGAAAATTTCGGTCGTCGCAAGTCCCTGATCTAC
GGAGCCATCTGGATGTTTATCATGTTTATGATCTTCTCATCCATCGGCCATTTCGTTCTGGATGTGGAAACACCT
ACCAATACCCCCAACGCTGGCAAGGGTATGATTGTCGTCGCTTGCTTGTTCATTGCGGCATATGCTATGACCTGG
GGTCCCATGGTTTGGGCGATTGTCGCAGAGCTCTTCCCCTCAAAGTACCGTGCCAAGGGTATGGCCTTAGCTACT
GCAACGAACTGGCTGTGGAACTTCCTCATCAGCTTTTTCACAACTTTCATCACCAAGGACATCGACTTTGCCTAT
GGATACGTCTTCGCTGGTTGCCTTTTCGTGGCTATCGGCGTCGTCTATTTCTTCGTTATTGAAGGAAAGGGCCGT
ACACTTGAGGAGCTTGACTGGATGTATGTCAACAAGGTTGTTCCCTGGAAGAGCAGCAGCTACGAGATTCCCGAA
CGCCACCAGGACTGGATTGCGGATGAGAACCCTTACGGTCGGAAGTCAGAGGGAACCATACACGCAGAGAACGCA
TGA
Gene >Pro_DTO377G3_2|g8428.t1
ATGGGTGCCGAATCGTTCCCCCACCATGGGGAGTCCATCACACAGGCTCAACAGCCAAGCCTCGAGTCGTCCCCT
CAAAATAGTCCTATGGAGAAACACATGCGACCCGTGGGTATCGATACCCCAATCCCTCGGATAACCATGCGGTCC
TTGGTGATGGCCCTCTTTGTCTCGATGGGTGGTCTGCTGTTTGGATATGACACAGGTCAGATTTCTGGCTTCCAA
GAAATGAGCAACTACTTGGAGCGGTATGGTGAGCTTGGCGCCGATGGTTCCTATAAATTCAGCACCGTGCGCTCC
GGTCTCATTGTCGCCTTGTTGTCCATCGGTACCATGATCGGTGCCCTGGTCGGAGCCCCCGTCGCCGATAAATTG
GGCCGGAAGTGGTCCATCACCCTCTGGTGTATGATCCTCAACGTCGGTTTGATCGTTCAAATTACCTCTCCCGAT
GGCCATTGGTACCAGATGGTTGTTGGCCGCTGGGTCACTGGTCTTGGTGTTGGTGGCTGCTCGCTGCTCGTGCCC
ATGTACCAGGGTGAAAGTGCACCTCGTCACATCCGGGGTGCCATGATCAGTTGCTACCAGCTGTTTGTTACTCTC
GGCATTTTCTTGGCCTACTGCATCAACCTGGGTACTCACACTCTGGATGGCACTGCTCAGTGGCGTATCACTCTC
GGTATCACCTTCGTCTTCGCTCTGATTCTCGGAGGCGGTATGATCTTCTTCCCGGAAAGCCCACGTTATGAATTT
CGCCACGGAAAGGCCGAGAGTGCCCAAAGCACCCTGGCCAAGCTCTACGGCATCCCAGAGAACCATGTCCGCATC
TTGGAAGAAATGAACGAGATTCGTGAGCAGTTTGAAGCGGAGTCTGAGGGCCAGAAGTGGGATGAATTCCTCACT
GCCCCCCGCATGTTCTATCGTATTGTCCTTGGCATGGTTCTGCAGTCACTGCAGCAGCTCAGCGGTGCTAACTAC
TTTTTCTACTACGTAAGTTCCTACACAAGCCTTTTCTTCTATTTTGGGATCTTGGTGCGAGGAATTGCTGACACC
GATTTCTTTGATAGGGTACCACTATCTTCGAAGGCGCTGGTCTCTCGGACAGCTTCGTGACCCAGTGTATCCTTG
GTGCTGTGAATTTTGGAACTACATTTGGCGGCCTATATGTCGTGGAAAATTTCGGTCGTCGCAAGTCCCTGATCT
ACGGAGCCATCTGGATGTTTATCATGTTTATGATCTTCTCATCCATCGGCCATTTCGTTCTGGATGTGGAAACAC
CTACCAATACCCCCAACGCTGGCAAGGGTATGATTGTCGTCGCTTGCTTGTTCATTGCGGCATATGCTATGACCT
GGGGTCCCATGGTTTGGGCGATTGTCGCAGAGCTCTTCCCCTCAAAGTACCGTGCCAAGGGTATGGCCTTAGCTA
CTGCAACGAACTGGCTGTGGAACTTCCTCATCAGCTTTTTCACAACTTTCATCACCAAGGACATCGACTTTGCCT
ATGGATACGTCTTCGCTGGTTGCCTTTTCGTGGCTATCGGCGTCGTCTATTTCTTCGTTATTGAAGGAAAGGGCC
GTACACTTGAGGAGCTTGACTGGATGTATGTCAACAAGGTTGTTCCCTGGAAGAGCAGCAGCTACGAGATTCCCG
AACGCCACCAGGACTGGATTGCGGATGAGAACCCTTACGGTCGGAAGTCAGAGGGAACCATACACGCAGAGAACG
CATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail